Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   C7M28_RS06760 Genome accession   NZ_CP028215
Coordinates   1272675..1272815 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM102750     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1267675..1277815
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M28_RS06735 (C7M28_01327) yuxO 1267952..1268332 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  C7M28_RS06740 (C7M28_01328) comA 1268351..1268995 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  C7M28_RS06745 (C7M28_01329) comP 1269076..1271388 (-) 2313 WP_041332996.1 sensor histidine kinase Regulator
  C7M28_RS06750 (C7M28_01330) comX 1271404..1271625 (-) 222 WP_014480704.1 competence pheromone ComX -
  C7M28_RS06755 (C7M28_01331) - 1271627..1272490 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  C7M28_RS06760 (C7M28_01332) degQ 1272675..1272815 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  C7M28_RS06765 (C7M28_01333) - 1273037..1273162 (+) 126 WP_003228793.1 hypothetical protein -
  C7M28_RS06770 (C7M28_01334) - 1273277..1273645 (+) 369 WP_046381300.1 hypothetical protein -
  C7M28_RS06775 (C7M28_01335) pdeH 1273621..1274850 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  C7M28_RS06780 (C7M28_01336) pncB 1274987..1276459 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  C7M28_RS06785 (C7M28_01337) pncA 1276475..1277026 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  C7M28_RS06790 (C7M28_01338) yueI 1277123..1277521 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=283253 C7M28_RS06760 WP_003220708.1 1272675..1272815(-) (degQ) [Bacillus subtilis strain SRCM102750]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=283253 C7M28_RS06760 WP_003220708.1 1272675..1272815(-) (degQ) [Bacillus subtilis strain SRCM102750]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment