Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   C7M28_RS03220 Genome accession   NZ_CP028215
Coordinates   605408..605581 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM102750     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 600408..610581
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M28_RS03205 (C7M28_00636) gcvT 601208..602296 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  C7M28_RS03210 (C7M28_00637) hepAA 602737..604410 (+) 1674 WP_029726726.1 SNF2-related protein -
  C7M28_RS03215 (C7M28_00638) yqhG 604431..605225 (+) 795 WP_015714249.1 YqhG family protein -
  C7M28_RS03220 (C7M28_00639) sinI 605408..605581 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  C7M28_RS03225 (C7M28_00640) sinR 605615..605950 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C7M28_RS03230 (C7M28_00641) tasA 606043..606828 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  C7M28_RS03235 (C7M28_00642) sipW 606892..607464 (-) 573 WP_003230181.1 signal peptidase I SipW -
  C7M28_RS03240 (C7M28_00643) tapA 607448..608209 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  C7M28_RS03245 (C7M28_00644) yqzG 608481..608807 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  C7M28_RS03250 (C7M28_00645) spoIITA 608849..609028 (-) 180 WP_029726723.1 YqzE family protein -
  C7M28_RS03255 (C7M28_00646) comGG 609100..609474 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  C7M28_RS03260 comGF 609475..609858 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  C7M28_RS03265 (C7M28_00648) comGE 609884..610231 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=283229 C7M28_RS03220 WP_003230187.1 605408..605581(+) (sinI) [Bacillus subtilis strain SRCM102750]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=283229 C7M28_RS03220 WP_003230187.1 605408..605581(+) (sinI) [Bacillus subtilis strain SRCM102750]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment