Detailed information    

insolico Bioinformatically predicted

Overview


Name   comEA   Type   Machinery gene
Locus tag   C7M26_RS00860 Genome accession   NZ_CP028212
Coordinates   131910..132527 (+) Length   205 a.a.
NCBI ID   WP_032722140.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM102748     
Function   dsDNA binding to the cell surface (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 73834..135497 131910..132527 within 0


Gene organization within MGE regions


Location: 73834..135497
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M26_RS00455 (C7M26_00083) sknR 73834..74184 (-) 351 WP_004398704.1 transcriptional regulator SknR -
  C7M26_RS00460 (C7M26_00084) yqaF 74361..74591 (+) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  C7M26_RS00465 (C7M26_00085) - 74621..74761 (+) 141 WP_003229902.1 hypothetical protein -
  C7M26_RS00470 (C7M26_00086) yqaG 74835..75404 (+) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  C7M26_RS00475 (C7M26_00087) sknH 75401..75658 (+) 258 WP_003245994.1 YqaH family protein -
  C7M26_RS00480 (C7M26_00088) - 75655..75828 (+) 174 WP_119123069.1 hypothetical protein -
  C7M26_RS00485 (C7M26_00089) - 75788..75982 (+) 195 WP_003229905.1 hypothetical protein -
  C7M26_RS00490 (C7M26_00090) yqaJ 76088..77047 (+) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  C7M26_RS00495 (C7M26_00091) recT 77050..77904 (+) 855 WP_003229907.1 recombinase RecT -
  C7M26_RS00500 (C7M26_00092) yqaL 77980..78657 (+) 678 WP_116362964.1 DnaD domain protein -
  C7M26_RS00505 (C7M26_00093) sknM 78539..79480 (+) 942 WP_075058863.1 ATP-binding protein -
  C7M26_RS00510 (C7M26_00094) - 79471..79620 (+) 150 WP_003229910.1 hypothetical protein -
  C7M26_RS00515 (C7M26_00095) yqaN 79716..80144 (+) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  C7M26_RS00520 (C7M26_00096) yqaO 80226..80432 (+) 207 WP_003229912.1 XtrA/YqaO family protein -
  C7M26_RS00525 (C7M26_00097) - 80506..81435 (-) 930 WP_003229913.1 hypothetical protein -
  C7M26_RS00530 (C7M26_00098) yqaQ 81633..82088 (+) 456 WP_004398775.1 hypothetical protein -
  C7M26_RS00535 (C7M26_00099) - 82232..82696 (+) 465 WP_004398685.1 hypothetical protein -
  C7M26_RS00540 (C7M26_00100) terS 82764..83483 (+) 720 WP_048655095.1 phage terminase small subunit -
  C7M26_RS00545 (C7M26_00101) stmB 83476..84771 (+) 1296 WP_015714325.1 PBSX family phage terminase large subunit -
  C7M26_RS00550 (C7M26_00102) yqbA 84775..86307 (+) 1533 WP_015714324.1 phage portal protein -
  C7M26_RS00555 (C7M26_00103) yqbB 86304..87221 (+) 918 WP_004398748.1 phage head morphogenesis protein -
  C7M26_RS00560 (C7M26_00104) - 87262..87915 (+) 654 WP_003229920.1 hypothetical protein -
  C7M26_RS00565 (C7M26_00105) yqbD 87948..88916 (+) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  C7M26_RS00570 (C7M26_00106) skdG 88935..89870 (+) 936 WP_003229922.1 phage major capsid protein -
  C7M26_RS00575 (C7M26_00107) yqbF 89881..90192 (+) 312 WP_003229923.1 YqbF domain-containing protein -
  C7M26_RS00580 (C7M26_00108) gkpG 90196..90591 (+) 396 WP_004398566.1 DUF3199 family protein -
  C7M26_RS00585 (C7M26_00109) yqbH 90588..90950 (+) 363 WP_003229925.1 YqbH/XkdH family protein -
  C7M26_RS00590 (C7M26_00110) yqbI 90947..91450 (+) 504 WP_003246050.1 HK97 gp10 family phage protein -
  C7M26_RS00595 (C7M26_00111) yqbJ 91463..91900 (+) 438 WP_003229927.1 DUF6838 family protein -
  C7M26_RS00600 (C7M26_00112) - 91897..92088 (+) 192 WP_010886574.1 hypothetical protein -
  C7M26_RS00605 (C7M26_00113) yqbK 92089..93489 (+) 1401 WP_003229929.1 phage tail sheath family protein -
  C7M26_RS00610 (C7M26_00114) yqbM 93492..93935 (+) 444 WP_003229930.1 phage tail tube protein -
  C7M26_RS00615 bsrH 94189..94278 (-) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  C7M26_RS00620 (C7M26_00115) txpA 94650..94829 (-) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  C7M26_RS00625 (C7M26_00116) - 94975..95424 (+) 450 WP_032722171.1 phage portal protein -
  C7M26_RS00630 - 95466..95603 (+) 138 WP_021480099.1 hypothetical protein -
  C7M26_RS00635 (C7M26_00117) yqbO 95606..100363 (+) 4758 WP_032722170.1 phage tail tape measure protein -
  C7M26_RS00640 (C7M26_00118) yqbP 100356..101015 (+) 660 WP_032722169.1 LysM peptidoglycan-binding domain-containing protein -
  C7M26_RS00645 (C7M26_00119) yqbQ 101028..102008 (+) 981 WP_032722168.1 hypothetical protein -
  C7M26_RS00650 (C7M26_00120) yqbR 102005..102271 (+) 267 WP_032722167.1 DUF2577 family protein -
  C7M26_RS00655 (C7M26_00121) yqbS 102284..102709 (+) 426 WP_032722166.1 DUF2634 domain-containing protein -
  C7M26_RS00660 (C7M26_00122) yqbT 102702..103748 (+) 1047 WP_032722165.1 baseplate J/gp47 family protein -
  C7M26_RS00665 (C7M26_00123) yqcA 103732..104310 (+) 579 WP_032722164.1 YmfQ family protein -
  C7M26_RS00670 (C7M26_00124) - 104307..104579 (+) 273 WP_032722163.1 hypothetical protein -
  C7M26_RS00675 (C7M26_00125) yqcC 104583..105683 (+) 1101 WP_032722161.1 pyocin knob domain-containing protein -
  C7M26_RS00680 (C7M26_00126) yqcD 105693..106028 (+) 336 WP_009967793.1 XkdW family protein -
  C7M26_RS00685 (C7M26_00127) yqcE 106025..106189 (+) 165 WP_003229944.1 XkdX family protein -
  C7M26_RS00690 (C7M26_00128) xepAK 106277..107170 (+) 894 WP_032722160.1 hypothetical protein -
  C7M26_RS00695 (C7M26_00129) skhD 107216..107638 (+) 423 WP_017697460.1 holin family protein -
  C7M26_RS00700 (C7M26_00130) cwlA 107683..108501 (+) 819 WP_017697459.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  C7M26_RS00705 (C7M26_00131) - 108666..109145 (+) 480 WP_004399085.1 hypothetical protein -
  C7M26_RS00710 (C7M26_00132) - 109161..109523 (+) 363 WP_003229947.1 hypothetical protein -
  C7M26_RS00715 (C7M26_00133) - 109520..109666 (-) 147 WP_009967791.1 hypothetical protein -
  C7M26_RS00720 (C7M26_00134) yqcF 109784..110362 (-) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  C7M26_RS00725 (C7M26_00135) yqcG 110377..111972 (-) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  C7M26_RS00730 (C7M26_00136) - 112342..112500 (-) 159 WP_003245945.1 hypothetical protein -
  C7M26_RS00735 (C7M26_00137) phrE 112610..112744 (-) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  C7M26_RS00740 (C7M26_00138) rapE 112734..113861 (-) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  C7M26_RS00745 (C7M26_00139) yqcI 114304..115068 (+) 765 WP_017696291.1 YqcI/YcgG family protein -
  C7M26_RS00750 (C7M26_00140) arsR 115433..115750 (+) 318 WP_029318103.1 arsenical resistance operon transcriptional regulator ArsR -
  C7M26_RS00755 (C7M26_00141) arsK 115809..116249 (+) 441 WP_032722151.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  C7M26_RS00760 (C7M26_00142) acr3 116272..117312 (+) 1041 WP_032722149.1 arsenite efflux transporter Acr3 -
  C7M26_RS00765 (C7M26_00143) arsC 117324..117743 (+) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  C7M26_RS22100 - 118098..118276 (+) 179 Protein_158 hypothetical protein -
  C7M26_RS00770 (C7M26_00144) spoIVCA 118234..119694 (+) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  C7M26_RS00775 (C7M26_00145) - 119725..120072 (-) 348 Protein_160 sigma-70 family RNA polymerase sigma factor -
  C7M26_RS00780 (C7M26_00146) nucA/comI 120268..120678 (+) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  C7M26_RS00785 (C7M26_00147) yqeB 120711..121433 (-) 723 WP_010886572.1 hypothetical protein -
  C7M26_RS00790 (C7M26_00148) gnd 121685..122553 (+) 869 Protein_163 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  C7M26_RS00795 (C7M26_00150) yqeD 122572..123198 (-) 627 WP_015714297.1 TVP38/TMEM64 family protein -
  C7M26_RS00800 (C7M26_00151) cwlH 123385..124137 (+) 753 WP_032722147.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  C7M26_RS00805 (C7M26_00152) yqeF 124389..125120 (+) 732 WP_032722145.1 SGNH/GDSL hydrolase family protein -
  C7M26_RS00810 - 125426..125566 (-) 141 WP_003226124.1 sporulation histidine kinase inhibitor Sda -
  C7M26_RS00815 (C7M26_00154) yqeG 125928..126446 (+) 519 WP_003226126.1 YqeG family HAD IIIA-type phosphatase -
  C7M26_RS00820 (C7M26_00155) yqeH 126450..127550 (+) 1101 WP_003229966.1 ribosome biogenesis GTPase YqeH -
  C7M26_RS00825 (C7M26_00156) aroE 127568..128410 (+) 843 WP_003229967.1 shikimate dehydrogenase -
  C7M26_RS00830 (C7M26_00157) yhbY 128404..128694 (+) 291 WP_003226133.1 ribosome assembly RNA-binding protein YhbY -
  C7M26_RS00835 (C7M26_00158) nadD 128706..129275 (+) 570 WP_004398676.1 nicotinate-nucleotide adenylyltransferase -
  C7M26_RS00840 (C7M26_00159) yqeK 129265..129825 (+) 561 WP_004399059.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK -
  C7M26_RS00845 (C7M26_00160) rsfS 129843..130199 (+) 357 WP_014480315.1 ribosome silencing factor -
  C7M26_RS00850 (C7M26_00161) yqeM 130196..130939 (+) 744 WP_003229973.1 class I SAM-dependent methyltransferase -
  C7M26_RS00855 (C7M26_00162) comER 131005..131826 (-) 822 WP_032722142.1 late competence protein ComER -
  C7M26_RS00860 (C7M26_00163) comEA 131910..132527 (+) 618 WP_032722140.1 competence protein ComEA Machinery gene
  C7M26_RS00865 (C7M26_00164) comEB 132594..133163 (+) 570 WP_003229978.1 ComE operon protein 2 -
  C7M26_RS00870 (C7M26_00165) comEC 133167..135497 (+) 2331 WP_160214965.1 DNA internalization-related competence protein ComEC/Rec2 Machinery gene

Sequence


Protein


Download         Length: 205 a.a.        Molecular weight: 21748.46 Da        Isoelectric Point: 4.8354

>NTDB_id=283068 C7M26_RS00860 WP_032722140.1 131910..132527(+) (comEA) [Bacillus subtilis strain SRCM102748]
MNWLNQHKKAIILAASAAVFTAIMIFLATGKNKEPVKQAVPTETENTVVKQEANNDESNETIVIDIKGAVRHPGVYELRT
GDRVSQAIEKAGGTSEQADEAQVNLAEILQDGTVVYIPKKGEETAVQQGGGGSVQSDGGKGALVNINTATLEELQGISGV
GPSKAEAIIAYREENGRFPTIEDITKVSGIGEKSFEKIKSSITVK

Nucleotide


Download         Length: 618 bp        

>NTDB_id=283068 C7M26_RS00860 WP_032722140.1 131910..132527(+) (comEA) [Bacillus subtilis strain SRCM102748]
ATGAATTGGTTGAATCAGCATAAGAAAGCAATTATTTTAGCGGCTTCTGCGGCTGTTTTCACAGCGATTATGATCTTTCT
GGCCACAGGGAAAAATAAAGAGCCGGTGAAGCAAGCTGTACCAACAGAGACAGAAAATACAGTGGTAAAGCAGGAAGCAA
ACAACGACGAGTCAAATGAAACAATTGTGATAGACATCAAAGGTGCTGTTCGGCATCCTGGCGTTTATGAATTGCGAACA
GGGGACAGAGTATCTCAGGCAATTGAGAAAGCGGGCGGGACCAGTGAACAAGCAGACGAAGCGCAAGTAAATTTGGCGGA
GATTCTGCAGGACGGGACAGTGGTGTACATCCCGAAAAAGGGAGAGGAAACAGCAGTGCAGCAAGGTGGCGGAGGGTCTG
TCCAAAGCGATGGAGGGAAGGGAGCGCTGGTGAATATCAATACAGCAACCTTAGAGGAGTTACAAGGCATCTCAGGGGTG
GGGCCATCCAAAGCTGAAGCTATTATTGCATACCGGGAAGAAAACGGGCGTTTCCCAACAATTGAAGATATCACTAAGGT
TTCAGGAATAGGTGAAAAGTCATTTGAGAAAATAAAGTCTTCCATTACAGTAAAGTGA

Domains


Predicted by InterproScan.

(142-203)

(63-118)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comEA Bacillus subtilis subsp. subtilis str. 168

98.537

100

0.985

  comEA Staphylococcus aureus MW2

36.364

100

0.39

  comEA Staphylococcus aureus N315

35.455

100

0.38


Multiple sequence alignment