Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | C7M24_RS12450 | Genome accession | NZ_CP028210 |
| Coordinates | 2603007..2603180 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain SRCM102746 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2598007..2608180
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C7M24_RS12435 (C7M24_02504) | gcvT | 2598820..2599920 (-) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| C7M24_RS12440 (C7M24_02505) | - | 2600344..2602014 (+) | 1671 | WP_124934996.1 | DEAD/DEAH box helicase | - |
| C7M24_RS12445 (C7M24_02506) | - | 2602036..2602830 (+) | 795 | WP_076424968.1 | YqhG family protein | - |
| C7M24_RS12450 (C7M24_02507) | sinI | 2603007..2603180 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| C7M24_RS12455 (C7M24_02508) | sinR | 2603214..2603549 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| C7M24_RS12460 (C7M24_02509) | tasA | 2603597..2604382 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| C7M24_RS12465 (C7M24_02510) | sipW | 2604447..2605031 (-) | 585 | WP_160223172.1 | signal peptidase I SipW | - |
| C7M24_RS12470 (C7M24_02511) | tapA | 2605003..2605674 (-) | 672 | WP_160223173.1 | amyloid fiber anchoring/assembly protein TapA | - |
| C7M24_RS12475 (C7M24_02512) | - | 2605933..2606262 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| C7M24_RS12480 (C7M24_02513) | - | 2606302..2606481 (-) | 180 | WP_160223174.1 | YqzE family protein | - |
| C7M24_RS12485 (C7M24_02514) | comGG | 2606538..2606915 (-) | 378 | WP_160223175.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| C7M24_RS12490 (C7M24_02515) | comGF | 2606916..2607416 (-) | 501 | WP_257474763.1 | competence type IV pilus minor pilin ComGF | - |
| C7M24_RS12495 (C7M24_02516) | comGE | 2607325..2607639 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| C7M24_RS12500 (C7M24_02517) | comGD | 2607623..2608060 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=282959 C7M24_RS12450 WP_003153105.1 2603007..2603180(+) (sinI) [Bacillus velezensis strain SRCM102746]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=282959 C7M24_RS12450 WP_003153105.1 2603007..2603180(+) (sinI) [Bacillus velezensis strain SRCM102746]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |