Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   C7M24_RS02580 Genome accession   NZ_CP028210
Coordinates   515062..515181 (+) Length   39 a.a.
NCBI ID   WP_033575081.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM102746     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 510062..520181
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M24_RS02565 (C7M24_00511) - 511674..512357 (+) 684 WP_007410267.1 response regulator transcription factor -
  C7M24_RS02570 (C7M24_00512) - 512344..513777 (+) 1434 WP_162992601.1 sensor histidine kinase -
  C7M24_RS02575 (C7M24_00513) rapC 513930..515078 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  C7M24_RS02580 (C7M24_00514) phrC 515062..515181 (+) 120 WP_033575081.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  C7M24_RS02585 - 515330..515440 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  C7M24_RS02590 (C7M24_00516) - 515520..516884 (-) 1365 WP_059366589.1 aspartate kinase -
  C7M24_RS02595 (C7M24_00517) ceuB 517299..518252 (+) 954 WP_059366593.1 ABC transporter permease Machinery gene
  C7M24_RS02600 (C7M24_00518) - 518242..519189 (+) 948 WP_160222847.1 iron chelate uptake ABC transporter family permease subunit -
  C7M24_RS02605 (C7M24_00519) - 519183..519941 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4214.93 Da        Isoelectric Point: 8.0284

>NTDB_id=282929 C7M24_RS02580 WP_033575081.1 515062..515181(+) (phrC) [Bacillus velezensis strain SRCM102746]
MKLKSKWFVICLAAAAIFTVTGAGQTDQADFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=282929 C7M24_RS02580 WP_033575081.1 515062..515181(+) (phrC) [Bacillus velezensis strain SRCM102746]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGACTTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

72.5

100

0.744


Multiple sequence alignment