Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | C7M21_RS10940 | Genome accession | NZ_CP028207 |
| Coordinates | 2128757..2128930 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain SRCM102743 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2123757..2133930
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C7M21_RS10890 (C7M21_02180) | comGD | 2123877..2124314 (+) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| C7M21_RS10895 (C7M21_02181) | comGE | 2124298..2124612 (+) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| C7M21_RS10900 (C7M21_02182) | comGF | 2124521..2125021 (+) | 501 | WP_257474763.1 | competence type IV pilus minor pilin ComGF | - |
| C7M21_RS10905 (C7M21_02183) | comGG | 2125022..2125399 (+) | 378 | WP_160223175.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| C7M21_RS10910 (C7M21_02184) | - | 2125456..2125635 (+) | 180 | WP_160223174.1 | YqzE family protein | - |
| C7M21_RS10915 (C7M21_02185) | - | 2125675..2126004 (-) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| C7M21_RS10920 (C7M21_02186) | tapA | 2126263..2126934 (+) | 672 | WP_160223173.1 | amyloid fiber anchoring/assembly protein TapA | - |
| C7M21_RS10925 (C7M21_02187) | sipW | 2126906..2127490 (+) | 585 | WP_160223172.1 | signal peptidase I SipW | - |
| C7M21_RS10930 (C7M21_02188) | tasA | 2127555..2128340 (+) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| C7M21_RS10935 (C7M21_02189) | sinR | 2128388..2128723 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| C7M21_RS10940 (C7M21_02190) | sinI | 2128757..2128930 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| C7M21_RS10945 (C7M21_02191) | - | 2129107..2129901 (-) | 795 | WP_076424968.1 | YqhG family protein | - |
| C7M21_RS10950 (C7M21_02192) | - | 2129923..2131593 (-) | 1671 | WP_124934996.1 | DEAD/DEAH box helicase | - |
| C7M21_RS10955 (C7M21_02193) | gcvT | 2132017..2133117 (+) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=282733 C7M21_RS10940 WP_003153105.1 2128757..2128930(-) (sinI) [Bacillus velezensis strain SRCM102743]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=282733 C7M21_RS10940 WP_003153105.1 2128757..2128930(-) (sinI) [Bacillus velezensis strain SRCM102743]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |