Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   C7M20_RS14925 Genome accession   NZ_CP028206
Coordinates   3054260..3054400 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SRCM102742     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3049260..3059400
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M20_RS14900 (C7M20_03008) - 3049556..3049939 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  C7M20_RS14905 (C7M20_03009) comA 3049961..3050605 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  C7M20_RS14910 (C7M20_03010) comP 3050686..3052995 (-) 2310 WP_099567053.1 histidine kinase Regulator
  C7M20_RS14915 (C7M20_03011) - 3053015..3053191 (-) 177 WP_007408675.1 competence pheromone ComX -
  C7M20_RS14920 (C7M20_03012) comQ 3053191..3054075 (-) 885 WP_032865221.1 polyprenyl synthetase family protein Regulator
  C7M20_RS14925 (C7M20_03013) degQ 3054260..3054400 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  C7M20_RS14930 (C7M20_03014) - 3054865..3055206 (+) 342 WP_099567054.1 hypothetical protein -
  C7M20_RS14935 (C7M20_03015) - 3055213..3056436 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  C7M20_RS14940 (C7M20_03016) - 3056566..3058032 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  C7M20_RS14945 (C7M20_03017) - 3058050..3058601 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  C7M20_RS14950 (C7M20_03018) - 3058698..3059096 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=282669 C7M20_RS14925 WP_003152043.1 3054260..3054400(-) (degQ) [Bacillus velezensis strain SRCM102742]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=282669 C7M20_RS14925 WP_003152043.1 3054260..3054400(-) (degQ) [Bacillus velezensis strain SRCM102742]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment