Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | DA787_RS12375 | Genome accession | NZ_CP033205 |
| Coordinates | 2411329..2411502 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis strain MBI 600 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2406329..2416502
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DA787_RS12360 (DA787_12345) | gcvT | 2407128..2408216 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| DA787_RS12365 (DA787_12350) | hepAA | 2408658..2410331 (+) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| DA787_RS12370 (DA787_12355) | yqhG | 2410352..2411146 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| DA787_RS12375 (DA787_12360) | sinI | 2411329..2411502 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| DA787_RS12380 (DA787_12365) | sinR | 2411536..2411871 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| DA787_RS12385 (DA787_12370) | tasA | 2411964..2412749 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| DA787_RS12390 (DA787_12375) | sipW | 2412813..2413385 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| DA787_RS12395 (DA787_12380) | tapA | 2413369..2414130 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| DA787_RS12400 (DA787_12385) | yqzG | 2414402..2414728 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| DA787_RS12405 (DA787_12390) | spoIITA | 2414770..2414949 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| DA787_RS12410 (DA787_12395) | comGG | 2415020..2415394 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| DA787_RS12415 (DA787_12400) | comGF | 2415395..2415778 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| DA787_RS12420 (DA787_12405) | comGE | 2415804..2416151 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=282585 DA787_RS12375 WP_003230187.1 2411329..2411502(+) (sinI) [Bacillus subtilis strain MBI 600]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=282585 DA787_RS12375 WP_003230187.1 2411329..2411502(+) (sinI) [Bacillus subtilis strain MBI 600]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |