Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   DA787_RS12415 Genome accession   NZ_CP033205
Coordinates   2415395..2415778 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   P25958
Organism   Bacillus subtilis strain MBI 600     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2410395..2420778
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA787_RS12375 (DA787_12360) sinI 2411329..2411502 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  DA787_RS12380 (DA787_12365) sinR 2411536..2411871 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  DA787_RS12385 (DA787_12370) tasA 2411964..2412749 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  DA787_RS12390 (DA787_12375) sipW 2412813..2413385 (-) 573 WP_003246088.1 signal peptidase I SipW -
  DA787_RS12395 (DA787_12380) tapA 2413369..2414130 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  DA787_RS12400 (DA787_12385) yqzG 2414402..2414728 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  DA787_RS12405 (DA787_12390) spoIITA 2414770..2414949 (-) 180 WP_003230176.1 YqzE family protein -
  DA787_RS12410 (DA787_12395) comGG 2415020..2415394 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  DA787_RS12415 (DA787_12400) comGF 2415395..2415778 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  DA787_RS12420 (DA787_12405) comGE 2415804..2416151 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  DA787_RS12425 (DA787_12410) comGD 2416135..2416566 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  DA787_RS12430 (DA787_12415) comGC 2416556..2416852 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  DA787_RS12435 (DA787_12420) comGB 2416866..2417903 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  DA787_RS12440 (DA787_12425) comGA 2417890..2418960 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  DA787_RS12450 (DA787_12435) corA 2419372..2420325 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=282588 DA787_RS12415 WP_003230168.1 2415395..2415778(-) (comGF) [Bacillus subtilis strain MBI 600]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=282588 DA787_RS12415 WP_003230168.1 2415395..2415778(-) (comGF) [Bacillus subtilis strain MBI 600]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P25958

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1