Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   D4I62_RS00960 Genome accession   NZ_CP032907
Coordinates   197180..197293 (+) Length   37 a.a.
NCBI ID   WP_139533029.1    Uniprot ID   -
Organism   Helicobacter pylori strain 24-A-EK1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 192180..202293
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4I62_RS00935 - 192242..194467 (+) 2226 WP_139533026.1 ATP-dependent Clp protease ATP-binding subunit -
  D4I62_RS00940 panD 194457..194810 (+) 354 WP_000142243.1 aspartate 1-decarboxylase -
  D4I62_RS00945 - 194813..195106 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  D4I62_RS00950 - 195106..196101 (+) 996 WP_139533027.1 PDZ domain-containing protein -
  D4I62_RS00955 comB6 196109..197164 (+) 1056 WP_139533028.1 P-type conjugative transfer protein TrbL Machinery gene
  D4I62_RS00960 comB7 197180..197293 (+) 114 WP_139533029.1 comB7 lipoprotein Machinery gene
  D4I62_RS00965 comB8 197290..198033 (+) 744 WP_139533030.1 virB8 family protein Machinery gene
  D4I62_RS00970 comB9 198033..199022 (+) 990 WP_139533031.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4I62_RS00975 comB10 199015..200151 (+) 1137 WP_139533032.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4I62_RS00980 - 200221..201633 (+) 1413 WP_139533033.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4339.28 Da        Isoelectric Point: 9.3572

>NTDB_id=280852 D4I62_RS00960 WP_139533029.1 197180..197293(+) (comB7) [Helicobacter pylori strain 24-A-EK1]
MRIFFVIMALVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=280852 D4I62_RS00960 WP_139533029.1 197180..197293(+) (comB7) [Helicobacter pylori strain 24-A-EK1]
ATGAGAATTTTTTTTGTTATTATGGCACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973