Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   D9C20_RS04085 Genome accession   NZ_CP032867
Coordinates   759003..759143 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain N4-2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 754003..764143
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C20_RS04060 (D9C20_04060) yuxO 754280..754660 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  D9C20_RS04065 (D9C20_04065) comA 754679..755323 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  D9C20_RS04070 (D9C20_04070) comP 755404..757716 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  D9C20_RS04075 (D9C20_04075) comX 757732..757953 (-) 222 WP_014480704.1 competence pheromone ComX -
  D9C20_RS04080 (D9C20_04080) comQ 757955..758818 (-) 864 WP_014480705.1 polyprenyl synthetase family protein Regulator
  D9C20_RS04085 (D9C20_04085) degQ 759003..759143 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  D9C20_RS04090 (D9C20_04090) - 759365..759490 (+) 126 WP_003228793.1 hypothetical protein -
  D9C20_RS04095 (D9C20_04095) - 759604..759972 (+) 369 WP_014477834.1 hypothetical protein -
  D9C20_RS04100 (D9C20_04100) pdeH 759948..761177 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  D9C20_RS04105 (D9C20_04105) pncB 761313..762785 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  D9C20_RS04110 (D9C20_04110) pncA 762801..763352 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  D9C20_RS04115 (D9C20_04115) yueI 763449..763847 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=280047 D9C20_RS04085 WP_003220708.1 759003..759143(-) (degQ) [Bacillus subtilis subsp. subtilis strain N4-2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=280047 D9C20_RS04085 WP_003220708.1 759003..759143(-) (degQ) [Bacillus subtilis subsp. subtilis strain N4-2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1