Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   D9C17_RS03015 Genome accession   NZ_CP032863
Coordinates   523405..523578 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis subsp. subtilis strain N2-2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 518405..528578
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C17_RS03000 (D9C17_03000) gcvT 519204..520292 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  D9C17_RS03005 (D9C17_03005) hepAA 520734..522407 (+) 1674 WP_014480248.1 SNF2-related protein -
  D9C17_RS03010 (D9C17_03010) yqhG 522428..523222 (+) 795 WP_014480249.1 YqhG family protein -
  D9C17_RS03015 (D9C17_03015) sinI 523405..523578 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  D9C17_RS03020 (D9C17_03020) sinR 523612..523947 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  D9C17_RS03025 (D9C17_03025) tasA 524040..524825 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  D9C17_RS03030 (D9C17_03030) sipW 524889..525461 (-) 573 WP_003230181.1 signal peptidase I SipW -
  D9C17_RS03035 (D9C17_03035) tapA 525445..526206 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  D9C17_RS03040 (D9C17_03040) yqzG 526478..526804 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  D9C17_RS03045 (D9C17_03045) spoIITA 526846..527025 (-) 180 WP_014480252.1 YqzE family protein -
  D9C17_RS03050 (D9C17_03050) comGG 527096..527470 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  D9C17_RS03055 (D9C17_03055) comGF 527471..527854 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  D9C17_RS03060 (D9C17_03060) comGE 527880..528227 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=279720 D9C17_RS03015 WP_003230187.1 523405..523578(+) (sinI) [Bacillus subtilis subsp. subtilis strain N2-2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=279720 D9C17_RS03015 WP_003230187.1 523405..523578(+) (sinI) [Bacillus subtilis subsp. subtilis strain N2-2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment