Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | D9C17_RS03015 | Genome accession | NZ_CP032863 |
| Coordinates | 523405..523578 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis subsp. subtilis strain N2-2 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 518405..528578
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D9C17_RS03000 (D9C17_03000) | gcvT | 519204..520292 (-) | 1089 | WP_014480247.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| D9C17_RS03005 (D9C17_03005) | hepAA | 520734..522407 (+) | 1674 | WP_014480248.1 | SNF2-related protein | - |
| D9C17_RS03010 (D9C17_03010) | yqhG | 522428..523222 (+) | 795 | WP_014480249.1 | YqhG family protein | - |
| D9C17_RS03015 (D9C17_03015) | sinI | 523405..523578 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| D9C17_RS03020 (D9C17_03020) | sinR | 523612..523947 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| D9C17_RS03025 (D9C17_03025) | tasA | 524040..524825 (-) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| D9C17_RS03030 (D9C17_03030) | sipW | 524889..525461 (-) | 573 | WP_003230181.1 | signal peptidase I SipW | - |
| D9C17_RS03035 (D9C17_03035) | tapA | 525445..526206 (-) | 762 | WP_014480251.1 | amyloid fiber anchoring/assembly protein TapA | - |
| D9C17_RS03040 (D9C17_03040) | yqzG | 526478..526804 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| D9C17_RS03045 (D9C17_03045) | spoIITA | 526846..527025 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| D9C17_RS03050 (D9C17_03050) | comGG | 527096..527470 (-) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| D9C17_RS03055 (D9C17_03055) | comGF | 527471..527854 (-) | 384 | WP_014480254.1 | ComG operon protein ComGF | Machinery gene |
| D9C17_RS03060 (D9C17_03060) | comGE | 527880..528227 (-) | 348 | WP_014480255.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=279720 D9C17_RS03015 WP_003230187.1 523405..523578(+) (sinI) [Bacillus subtilis subsp. subtilis strain N2-2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=279720 D9C17_RS03015 WP_003230187.1 523405..523578(+) (sinI) [Bacillus subtilis subsp. subtilis strain N2-2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |