Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   D9C17_RS03055 Genome accession   NZ_CP032863
Coordinates   527471..527854 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain N2-2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 522471..532854
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C17_RS03015 (D9C17_03015) sinI 523405..523578 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  D9C17_RS03020 (D9C17_03020) sinR 523612..523947 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  D9C17_RS03025 (D9C17_03025) tasA 524040..524825 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  D9C17_RS03030 (D9C17_03030) sipW 524889..525461 (-) 573 WP_003230181.1 signal peptidase I SipW -
  D9C17_RS03035 (D9C17_03035) tapA 525445..526206 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  D9C17_RS03040 (D9C17_03040) yqzG 526478..526804 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  D9C17_RS03045 (D9C17_03045) spoIITA 526846..527025 (-) 180 WP_014480252.1 YqzE family protein -
  D9C17_RS03050 (D9C17_03050) comGG 527096..527470 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  D9C17_RS03055 (D9C17_03055) comGF 527471..527854 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  D9C17_RS03060 (D9C17_03060) comGE 527880..528227 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  D9C17_RS03065 (D9C17_03065) comGD 528211..528642 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  D9C17_RS03070 (D9C17_03070) comGC 528632..528928 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  D9C17_RS03075 (D9C17_03075) comGB 528942..529979 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  D9C17_RS03080 (D9C17_03080) comGA 529966..531036 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  D9C17_RS03085 (D9C17_03085) - 531248..531445 (-) 198 WP_014480259.1 CBS domain-containing protein -
  D9C17_RS03090 (D9C17_03090) corA 531447..532400 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=279723 D9C17_RS03055 WP_014480254.1 527471..527854(-) (comGF) [Bacillus subtilis subsp. subtilis strain N2-2]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=279723 D9C17_RS03055 WP_014480254.1 527471..527854(-) (comGF) [Bacillus subtilis subsp. subtilis strain N2-2]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984