Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   CFK76_RS02380 Genome accession   NZ_CP032652
Coordinates   466239..466538 (+) Length   99 a.a.
NCBI ID   WP_025016383.1    Uniprot ID   -
Organism   Latilactobacillus sakei strain LZ217     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 461239..471538
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CFK76_RS02345 (CFK76_02345) - 461641..462255 (+) 615 WP_016265380.1 hypothetical protein -
  CFK76_RS02355 (CFK76_02355) - 462442..462816 (-) 375 WP_011375004.1 hypothetical protein -
  CFK76_RS02360 (CFK76_02360) - 462913..463413 (+) 501 WP_016265379.1 VanZ family protein -
  CFK76_RS02365 (CFK76_02365) - 463504..464235 (+) 732 WP_011375002.1 YebC/PmpR family DNA-binding transcriptional regulator -
  CFK76_RS02370 (CFK76_02370) comGA 464352..465242 (+) 891 WP_025016380.1 competence type IV pilus ATPase ComGA Machinery gene
  CFK76_RS02375 (CFK76_02375) comGB 465235..466242 (+) 1008 WP_061827023.1 type II secretion system F family protein Machinery gene
  CFK76_RS02380 (CFK76_02380) comGC 466239..466538 (+) 300 WP_025016383.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  CFK76_RS02385 (CFK76_02385) comGD 466558..466962 (+) 405 WP_235596237.1 hypothetical protein Machinery gene
  CFK76_RS02390 (CFK76_02390) comGE 466949..467254 (+) 306 WP_016265375.1 hypothetical protein Machinery gene
  CFK76_RS02395 (CFK76_02395) comGF 467229..467741 (+) 513 WP_035145013.1 competence type IV pilus minor pilin ComGF Machinery gene
  CFK76_RS02400 (CFK76_02400) - 467704..468042 (+) 339 WP_035145011.1 hypothetical protein -
  CFK76_RS02405 (CFK76_02405) - 468157..469176 (+) 1020 WP_235596233.1 class I SAM-dependent methyltransferase -
  CFK76_RS02410 (CFK76_02410) - 469198..470394 (+) 1197 WP_011374993.1 acetate/propionate family kinase -
  CFK76_RS02415 (CFK76_02415) - 470449..470907 (+) 459 WP_035145008.1 hypothetical protein -

Sequence


Protein


Download         Length: 99 a.a.        Molecular weight: 11067.03 Da        Isoelectric Point: 10.1321

>NTDB_id=277164 CFK76_RS02380 WP_025016383.1 466239..466538(+) (comGC) [Latilactobacillus sakei strain LZ217]
MKKKRNAFTLIEMVIVLAIVALLILLISPNLVAQKQRAEKKTDQALVTTLQTQVELAADEQGHQIKSLDELTDKYISKDQ
LKHAKEKGITIDSGTVKQK

Nucleotide


Download         Length: 300 bp        

>NTDB_id=277164 CFK76_RS02380 WP_025016383.1 466239..466538(+) (comGC) [Latilactobacillus sakei strain LZ217]
ATGAAGAAAAAAAGAAATGCTTTTACATTAATCGAAATGGTAATTGTTCTAGCAATTGTGGCGTTGTTAATTTTATTAAT
CTCACCAAATTTGGTGGCTCAAAAACAGCGCGCGGAGAAGAAAACCGATCAAGCTTTAGTGACGACTTTACAAACGCAAG
TTGAATTGGCTGCCGATGAACAAGGTCATCAAATTAAGAGTCTAGATGAATTAACGGATAAGTATATTTCAAAAGACCAA
TTAAAGCACGCAAAGGAGAAGGGGATTACAATTGATAGCGGCACGGTTAAGCAAAAATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Latilactobacillus sakei subsp. sakei 23K

89.899

100

0.899


Multiple sequence alignment