Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   ND02_RS09915 Genome accession   NZ_CP027435
Coordinates   1960084..1960713 (+) Length   209 a.a.
NCBI ID   WP_000841914.1    Uniprot ID   A0AAP9MNK0
Organism   Escherichia coli strain 2014C-3599     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1943865..1981472 1960084..1960713 within 0


Gene organization within MGE regions


Location: 1943865..1981472
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ND02_RS09845 zapC 1944889..1945431 (+) 543 WP_001338438.1 cell division protein ZapC -
  ND02_RS09850 ycbX 1945428..1946537 (-) 1110 WP_000224270.1 6-N-hydroxylaminopurine resistance protein YcbX -
  ND02_RS09855 rlmKL 1946780..1948888 (+) 2109 WP_001086532.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  ND02_RS09860 uup 1948900..1950807 (+) 1908 WP_000053123.1 ABC transporter ATP-binding protein -
  ND02_RS09865 pqiA 1950937..1952190 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  ND02_RS09870 pqiB 1952195..1953835 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  ND02_RS09875 pqiC 1953832..1954395 (+) 564 WP_000759120.1 membrane integrity-associated transporter subunit PqiC -
  ND02_RS09880 rmf 1954650..1954817 (+) 168 WP_000828648.1 ribosome modulation factor -
  ND02_RS09885 fabA 1954887..1955405 (-) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  ND02_RS09890 ycbZ 1955474..1957234 (-) 1761 WP_000156526.1 Lon protease family protein -
  ND02_RS09895 matP 1957420..1957872 (+) 453 WP_000877158.1 macrodomain Ter protein MatP -
  ND02_RS09900 ompA 1957947..1958999 (-) 1053 WP_000750419.1 porin OmpA -
  ND02_RS09910 sulA 1959356..1959865 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  ND02_RS09915 sxy/tfoX 1960084..1960713 (+) 630 WP_000841914.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  ND02_RS09920 yccS 1960676..1962838 (-) 2163 WP_000875061.1 YccS family putative transporter -
  ND02_RS09925 yccF 1962848..1963294 (-) 447 WP_001261235.1 YccF domain-containing protein -
  ND02_RS09930 helD 1963417..1965471 (+) 2055 WP_001295354.1 DNA helicase IV -
  ND02_RS09935 mgsA 1965503..1965961 (-) 459 WP_000424181.1 methylglyoxal synthase -
  ND02_RS09940 yccT 1966057..1966719 (-) 663 WP_000847791.1 DUF2057 family protein -
  ND02_RS09945 yccU 1966892..1967305 (+) 414 WP_000665217.1 CoA-binding protein -
  ND02_RS09950 hspQ 1967350..1967667 (-) 318 WP_001295356.1 heat shock protein HspQ -
  ND02_RS09955 rlmI 1967725..1968915 (-) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  ND02_RS09960 yccX 1969010..1969288 (+) 279 WP_000048233.1 acylphosphatase -
  ND02_RS09965 tusE 1969285..1969614 (-) 330 WP_000904442.1 sulfurtransferase TusE -
  ND02_RS09970 yccA 1969705..1970364 (-) 660 WP_000375136.1 FtsH protease modulator YccA -
  ND02_RS09975 - 1970772..1971791 (-) 1020 WP_001370339.1 tyrosine-type recombinase/integrase -
  ND02_RS09980 - 1971769..1972011 (-) 243 WP_000273151.1 DUF4224 domain-containing protein -
  ND02_RS09985 - 1972079..1974514 (-) 2436 WP_032212635.1 exonuclease -
  ND02_RS09990 - 1974595..1974798 (-) 204 WP_001098749.1 DUF1482 family protein -
  ND02_RS09995 dicB 1974801..1974983 (-) 183 WP_000449182.1 cell division inhibition protein DicB -
  ND02_RS10005 - 1975729..1976118 (-) 390 WP_000394568.1 hypothetical protein -
  ND02_RS10010 - 1976130..1976282 (-) 153 WP_000379585.1 DUF1391 family protein -
  ND02_RS10015 racR 1976598..1977074 (-) 477 WP_000948459.1 DNA-binding transcriptional repressor RacR -
  ND02_RS10020 ydaS 1977198..1977494 (+) 297 WP_000712069.1 toxin YdaS -
  ND02_RS10025 - 1977517..1977942 (+) 426 WP_000693884.1 toxin YdaT family protein -
  ND02_RS10030 - 1978014..1979084 (+) 1071 WP_001262384.1 hypothetical protein -
  ND02_RS10035 - 1979125..1979547 (+) 423 WP_001151153.1 DUF977 family protein -
  ND02_RS10040 - 1979544..1979840 (+) 297 WP_001266134.1 DUF4406 domain-containing protein -
  ND02_RS10045 - 1979837..1980298 (+) 462 WP_001209480.1 sigma-E factor regulatory protein RseB domain-containing protein -
  ND02_RS10050 - 1980276..1980632 (+) 357 WP_000403777.1 hypothetical protein -
  ND02_RS10055 - 1980683..1980895 (+) 213 WP_000935420.1 hypothetical protein -
  ND02_RS10060 - 1980928..1981145 (+) 218 Protein_1848 DUF4014 family protein -
  ND02_RS10065 - 1981147..1981410 (+) 264 WP_000224233.1 hypothetical protein -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24130.97 Da        Isoelectric Point: 9.2180

>NTDB_id=277167 ND02_RS09915 WP_000841914.1 1960084..1960713(+) (sxy/tfoX) [Escherichia coli strain 2014C-3599]
MKSPSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=277167 ND02_RS09915 WP_000841914.1 1960084..1960713(+) (sxy/tfoX) [Escherichia coli strain 2014C-3599]
ATGAAAAGCCCCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.522

100

0.995

Multiple sequence alignment