Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | C5I45_RS07735 | Genome accession | NZ_CP027061 |
| Coordinates | 1466618..1466791 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus sp. ZY-1-1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1461618..1471791
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C5I45_RS07685 (C5I45_07675) | comGD | 1461739..1462176 (+) | 438 | WP_025852922.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| C5I45_RS07690 (C5I45_07680) | comGE | 1462160..1462474 (+) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| C5I45_RS07695 (C5I45_07685) | comGF | 1462383..1462883 (+) | 501 | WP_226565836.1 | competence type IV pilus minor pilin ComGF | - |
| C5I45_RS07700 (C5I45_07690) | comGG | 1462884..1463261 (+) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| C5I45_RS07705 (C5I45_07695) | - | 1463318..1463497 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| C5I45_RS07710 (C5I45_07700) | - | 1463537..1463866 (-) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| C5I45_RS07715 (C5I45_07705) | tapA | 1464125..1464796 (+) | 672 | WP_014305409.1 | amyloid fiber anchoring/assembly protein TapA | - |
| C5I45_RS07720 (C5I45_07710) | - | 1464768..1465352 (+) | 585 | WP_025852917.1 | signal peptidase I | - |
| C5I45_RS07725 (C5I45_07715) | - | 1465416..1466201 (+) | 786 | WP_003153102.1 | TasA family protein | - |
| C5I45_RS07730 (C5I45_07720) | sinR | 1466249..1466584 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| C5I45_RS07735 (C5I45_07725) | sinI | 1466618..1466791 (-) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| C5I45_RS07740 (C5I45_07730) | - | 1466968..1467762 (-) | 795 | WP_014305407.1 | YqhG family protein | - |
| C5I45_RS07745 (C5I45_07735) | - | 1467780..1469450 (-) | 1671 | WP_003153107.1 | SNF2-related protein | - |
| C5I45_RS07750 (C5I45_07740) | gcvT | 1469873..1470973 (+) | 1101 | WP_003153108.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=274813 C5I45_RS07735 WP_003153105.1 1466618..1466791(-) (sinI) [Bacillus sp. ZY-1-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=274813 C5I45_RS07735 WP_003153105.1 1466618..1466791(-) (sinI) [Bacillus sp. ZY-1-1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |