Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LLMG_RS12045 Genome accession   NC_009004
Coordinates   2343546..2343845 (-) Length   99 a.a.
NCBI ID   WP_011836042.1    Uniprot ID   A2RNS3
Organism   Lactococcus cremoris subsp. cremoris MG1363     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2339003..2352968 2343546..2343845 within 0


Gene organization within MGE regions


Location: 2339003..2352968
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLMG_RS13320 - 2339003..2340398 (-) 1396 Protein_2335 IS3 family transposase -
  LLMG_RS12025 (llmg_2398) - 2340471..2341280 (-) 810 WP_011836038.1 metal ABC transporter permease -
  LLMG_RS12030 (llmg_2399) - 2341273..2342010 (-) 738 WP_011836039.1 metal ABC transporter ATP-binding protein -
  LLMG_RS12035 (llmg_2400) - 2342189..2343031 (-) 843 WP_011836040.1 metal ABC transporter solute-binding protein, Zn/Mn family -
  LLMG_RS12040 (llmg_2401) - 2343028..2343465 (-) 438 WP_011836041.1 zinc-dependent MarR family transcriptional regulator -
  LLMG_RS12045 (llmg_2402) comGG 2343546..2343845 (-) 300 WP_011836042.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLMG_RS12050 (llmg_2403) comGF 2343869..2344294 (-) 426 WP_014735174.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLMG_RS12055 (llmg_2404) comGE 2344278..2344574 (-) 297 WP_014735175.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLMG_RS12060 (llmg_2405) comGD 2344546..2344977 (-) 432 WP_050750513.1 competence type IV pilus minor pilin ComGD Machinery gene
  LLMG_RS12065 (llmg_2406) comGC 2344937..2345314 (-) 378 WP_011836046.1 competence type IV pilus major pilin ComGC Machinery gene
  LLMG_RS12070 (llmg_2407) comGB 2345332..2346357 (-) 1026 WP_042211510.1 competence type IV pilus assembly protein ComGB Machinery gene
  LLMG_RS12075 (llmg_2408) comGA 2346257..2347237 (-) 981 WP_011836048.1 competence type IV pilus ATPase ComGA Machinery gene
  LLMG_RS12080 (llmg_2409) - 2347351..2351133 (-) 3783 Protein_2347 PolC-type DNA polymerase III -
  LLMG_RS14065 - 2351665..2352258 (-) 594 Protein_2348 PolC-type DNA polymerase III N-terminal domain-containing protein -
  LLMG_RS12085 (llmg_2410) - 2352432..2352968 (-) 537 WP_011836050.1 hypothetical protein -

Sequence

Protein


Download         Length: 99 a.a.        Molecular weight: 11211.23 Da        Isoelectric Point: 10.0446

>NTDB_id=27480 LLMG_RS12045 WP_011836042.1 2343546..2343845(-) (comGG) [Lactococcus cremoris subsp. cremoris MG1363]
MVLLLIFSLFLQFYLQKQVLTAQQLKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSAGSTSGGQTVSN
KTYCFDVRLKDGRIFQIKK

Nucleotide


Download         Length: 300 bp        

>NTDB_id=27480 LLMG_RS12045 WP_011836042.1 2343546..2343845(-) (comGG) [Lactococcus cremoris subsp. cremoris MG1363]
TTGGTTTTACTGCTAATTTTTTCTTTATTTCTACAGTTTTATTTGCAAAAACAGGTGCTTACAGCTCAGCAATTGAAAAT
AGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCAACTTAATT
TTGATTGTGGAAATTTAACTTATAAATTACTGACAGATCTGTCAGCTGGTTCAACTAGCGGTGGTCAAACTGTTAGTAAT
AAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGGATTTTTCAAATAAAAAAGTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A2RNS3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

98.99

100

0.99

Multiple sequence alignment