Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   C5Y82_RS14815 Genome accession   NZ_CP027034
Coordinates   2870374..2870514 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain 150a     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2865374..2875514
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C5Y82_RS14790 (C5Y82_14790) - 2865696..2866085 (-) 390 WP_003213775.1 hotdog fold thioesterase -
  C5Y82_RS14795 (C5Y82_14795) comA 2866109..2866750 (-) 642 WP_003213500.1 response regulator transcription factor Regulator
  C5Y82_RS14800 (C5Y82_14800) comP 2866831..2869137 (-) 2307 WP_012011106.1 ATP-binding protein Regulator
  C5Y82_RS14805 (C5Y82_14805) comX 2869151..2869330 (-) 180 WP_313960228.1 competence pheromone ComX -
  C5Y82_RS14810 (C5Y82_14810) - 2869299..2870222 (-) 924 WP_012011108.1 polyprenyl synthetase family protein -
  C5Y82_RS14815 (C5Y82_14815) degQ 2870374..2870514 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  C5Y82_RS14820 (C5Y82_14820) - 2871020..2871373 (+) 354 WP_012011109.1 hypothetical protein -
  C5Y82_RS14825 (C5Y82_14825) - 2871405..2872631 (-) 1227 WP_012011110.1 HDOD domain-containing protein -
  C5Y82_RS14830 (C5Y82_14830) - 2872771..2874240 (-) 1470 WP_119125304.1 nicotinate phosphoribosyltransferase -
  C5Y82_RS14835 (C5Y82_14835) - 2874258..2874809 (-) 552 WP_012011112.1 isochorismatase family cysteine hydrolase -
  C5Y82_RS14840 (C5Y82_14840) - 2874870..2875277 (-) 408 WP_012011113.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=274666 C5Y82_RS14815 WP_003213123.1 2870374..2870514(-) (degQ) [Bacillus pumilus strain 150a]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=274666 C5Y82_RS14815 WP_003213123.1 2870374..2870514(-) (degQ) [Bacillus pumilus strain 150a]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAGTACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment