Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   C4N11_RS08035 Genome accession   NZ_CP026670
Coordinates   1519513..1520058 (-) Length   181 a.a.
NCBI ID   WP_000609575.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain endophthalmitis isolate 335     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1487864..1541049 1519513..1520058 within 0


Gene organization within MGE regions


Location: 1487864..1541049
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C4N11_RS07850 (C4N11_07850) - 1487864..1488820 (-) 957 WP_000350453.1 N-acetylmuramoyl-L-alanine amidase family protein -
  C4N11_RS07855 (C4N11_07855) - 1488824..1489156 (-) 333 WP_001186206.1 phage holin -
  C4N11_RS07860 (C4N11_07860) - 1489160..1489576 (-) 417 WP_000687454.1 phage holin family protein -
  C4N11_RS07865 (C4N11_07865) - 1489586..1489855 (-) 270 WP_015968626.1 hypothetical protein -
  C4N11_RS07870 (C4N11_07870) - 1489909..1491987 (-) 2079 WP_000159973.1 DUF859 family phage minor structural protein -
  C4N11_RS07875 (C4N11_07875) - 1491998..1497025 (-) 5028 WP_000927607.1 phage tail protein -
  C4N11_RS07880 (C4N11_07880) - 1497027..1498541 (-) 1515 WP_000161549.1 distal tail protein Dit -
  C4N11_RS07885 (C4N11_07885) - 1498538..1501819 (-) 3282 WP_000763178.1 tape measure protein -
  C4N11_RS07890 (C4N11_07890) - 1501812..1502381 (-) 570 WP_000062049.1 Gp15 family bacteriophage protein -
  C4N11_RS07895 (C4N11_07895) - 1502394..1502882 (-) 489 WP_000129838.1 hypothetical protein -
  C4N11_RS07900 (C4N11_07900) - 1502947..1503396 (-) 450 WP_000198230.1 hypothetical protein -
  C4N11_RS07905 (C4N11_07905) - 1503393..1503800 (-) 408 WP_001208881.1 minor capsid protein -
  C4N11_RS07910 (C4N11_07910) - 1503800..1504144 (-) 345 WP_001017359.1 minor capsid protein -
  C4N11_RS07915 (C4N11_07915) - 1504144..1504515 (-) 372 WP_000565932.1 putative minor capsid protein -
  C4N11_RS07920 (C4N11_07920) - 1504505..1504897 (-) 393 WP_000221834.1 hypothetical protein -
  C4N11_RS07925 (C4N11_07925) - 1504940..1505173 (-) 234 WP_001240344.1 hypothetical protein -
  C4N11_RS07930 (C4N11_07930) - 1505184..1506065 (-) 882 WP_001139818.1 hypothetical protein -
  C4N11_RS07935 (C4N11_07935) - 1506083..1506646 (-) 564 WP_000896122.1 phage scaffolding protein -
  C4N11_RS07940 (C4N11_07940) - 1506785..1507936 (-) 1152 WP_000730218.1 phage minor capsid protein -
  C4N11_RS12215 - 1507979..1508152 (-) 174 WP_000169861.1 hypothetical protein -
  C4N11_RS07945 (C4N11_07945) - 1508139..1509707 (-) 1569 WP_000051860.1 phage portal protein -
  C4N11_RS07950 (C4N11_07950) - 1509720..1511030 (-) 1311 WP_000143806.1 PBSX family phage terminase large subunit -
  C4N11_RS07955 (C4N11_07955) - 1511020..1511475 (-) 456 WP_001136857.1 KGG domain-containing protein -
  C4N11_RS07960 (C4N11_07960) - 1511679..1512425 (-) 747 WP_000057536.1 hypothetical protein -
  C4N11_RS07965 (C4N11_07965) - 1512406..1513500 (-) 1095 WP_000425577.1 DUF4417 domain-containing protein -
  C4N11_RS07970 (C4N11_07970) - 1513566..1513958 (-) 393 WP_000162611.1 hypothetical protein -
  C4N11_RS07975 (C4N11_07975) - 1513955..1514197 (-) 243 WP_001067626.1 DUF3310 domain-containing protein -
  C4N11_RS07980 (C4N11_07980) - 1514257..1514676 (-) 420 WP_000612390.1 YopX family protein -
  C4N11_RS12020 - 1514691..1514867 (-) 177 WP_158302876.1 hypothetical protein -
  C4N11_RS07985 (C4N11_07985) - 1514864..1515151 (-) 288 WP_000194857.1 hypothetical protein -
  C4N11_RS07990 (C4N11_07990) - 1515151..1515648 (-) 498 WP_001021764.1 DUF1642 domain-containing protein -
  C4N11_RS07995 (C4N11_07995) - 1515650..1515967 (-) 318 WP_000969681.1 hypothetical protein -
  C4N11_RS08000 (C4N11_08000) - 1516016..1516222 (-) 207 WP_000573750.1 hypothetical protein -
  C4N11_RS08005 (C4N11_08005) - 1516224..1516625 (-) 402 WP_000667209.1 hypothetical protein -
  C4N11_RS08010 (C4N11_08010) - 1516636..1516848 (-) 213 WP_001286809.1 hypothetical protein -
  C4N11_RS08015 (C4N11_08015) - 1516865..1517602 (-) 738 WP_000206142.1 hypothetical protein -
  C4N11_RS08020 (C4N11_08020) - 1517604..1518038 (-) 435 WP_000358623.1 hypothetical protein -
  C4N11_RS08025 (C4N11_08025) - 1518092..1518295 (-) 204 WP_000161128.1 hypothetical protein -
  C4N11_RS08030 (C4N11_08030) - 1518330..1519487 (-) 1158 WP_000670026.1 DNA cytosine methyltransferase -
  C4N11_RS08035 (C4N11_08035) ssb 1519513..1520058 (-) 546 WP_000609575.1 single-stranded DNA-binding protein Machinery gene
  C4N11_RS12220 - 1520048..1520224 (-) 177 WP_001203349.1 hypothetical protein -
  C4N11_RS08040 (C4N11_08040) - 1520246..1521238 (-) 993 WP_000237811.1 DUF1351 domain-containing protein -
  C4N11_RS08045 (C4N11_08045) - 1521241..1521948 (-) 708 WP_000774582.1 ERF family protein -
  C4N11_RS08050 (C4N11_08050) - 1521954..1522406 (-) 453 WP_001134282.1 hypothetical protein -
  C4N11_RS08055 (C4N11_08055) - 1522458..1522982 (-) 525 WP_000717373.1 hypothetical protein -
  C4N11_RS08060 (C4N11_08060) - 1523063..1523329 (-) 267 WP_000450965.1 hypothetical protein -
  C4N11_RS08065 (C4N11_08065) - 1523561..1523827 (-) 267 WP_000989839.1 Rrf2 family transcriptional regulator -
  C4N11_RS08070 (C4N11_08070) - 1524002..1524193 (-) 192 WP_001112906.1 hypothetical protein -
  C4N11_RS08075 (C4N11_08075) - 1524490..1524852 (+) 363 WP_000464163.1 helix-turn-helix domain-containing protein -
  C4N11_RS08080 (C4N11_08080) - 1524874..1525254 (+) 381 WP_000136430.1 ImmA/IrrE family metallo-endopeptidase -
  C4N11_RS08085 (C4N11_08085) - 1525268..1525618 (+) 351 WP_001020945.1 hypothetical protein -
  C4N11_RS08090 (C4N11_08090) - 1525737..1526864 (+) 1128 WP_000266853.1 site-specific integrase -
  C4N11_RS08095 (C4N11_08095) whiA 1526952..1527863 (-) 912 WP_000011276.1 DNA-binding protein WhiA -
  C4N11_RS08100 (C4N11_08100) - 1527860..1528837 (-) 978 WP_001231086.1 YvcK family protein -
  C4N11_RS08105 (C4N11_08105) rapZ 1528834..1529724 (-) 891 WP_000163035.1 RNase adapter RapZ -
  C4N11_RS08110 (C4N11_08110) - 1529776..1530156 (-) 381 WP_001140412.1 RidA family protein -
  C4N11_RS08115 (C4N11_08115) yihA 1530167..1530754 (-) 588 WP_000422605.1 ribosome biogenesis GTP-binding protein YihA/YsxC -
  C4N11_RS08120 (C4N11_08120) clpX 1530763..1531995 (-) 1233 WP_000106354.1 ATP-dependent Clp protease ATP-binding subunit ClpX Regulator
  C4N11_RS08125 (C4N11_08125) - 1532027..1532197 (-) 171 WP_000442276.1 hypothetical protein -
  C4N11_RS08130 (C4N11_08130) - 1532197..1532703 (-) 507 WP_000162437.1 dihydrofolate reductase -
  C4N11_RS08135 (C4N11_08135) - 1532833..1533351 (-) 519 WP_000229856.1 DNA starvation/stationary phase protection protein -
  C4N11_RS08140 (C4N11_08140) lytC 1533849..1535354 (-) 1506 WP_012386833.1 choline binding-anchored murein hydrolase LytC -
  C4N11_RS08145 (C4N11_08145) tpiA 1535392..1536150 (-) 759 WP_000087897.1 triose-phosphate isomerase -
  C4N11_RS08150 (C4N11_08150) - 1536248..1536925 (-) 678 WP_000221614.1 DnaD domain-containing protein -
  C4N11_RS08155 (C4N11_08155) metA 1536934..1537878 (-) 945 WP_001122712.1 homoserine O-succinyltransferase -
  C4N11_RS08160 (C4N11_08160) - 1538060..1538572 (-) 513 WP_001049323.1 adenine phosphoribosyltransferase -
  C4N11_RS08165 (C4N11_08165) - 1538660..1539418 (-) 759 WP_001287230.1 class I SAM-dependent methyltransferase -
  C4N11_RS12025 - 1539626..1539796 (+) 171 WP_000403103.1 hypothetical protein -
  C4N11_RS08170 (C4N11_08170) - 1539919..1541049 (-) 1131 WP_000229959.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 181 a.a.        Molecular weight: 20230.07 Da        Isoelectric Point: 5.1785

>NTDB_id=271440 C4N11_RS08035 WP_000609575.1 1519513..1520058(-) (ssb) [Streptococcus pneumoniae strain endophthalmitis isolate 335]
MINNVVLVGRLTRDAELRYTQSNIAVATFTLAVNRPFKNEAGEREADFINCVIWRQLAENLANWAKKGSLIGVTGVIQTR
SYDNQQGQRVYVTEVVASNFQLLESRNSQQNNQGHQDHHGGYQQQGYSNQGSSFQNGNSYGQQGSFVEGNTTNLVPDFTR
DNNPFGRPTNPLDISDDDLPF

Nucleotide


Download         Length: 546 bp        

>NTDB_id=271440 C4N11_RS08035 WP_000609575.1 1519513..1520058(-) (ssb) [Streptococcus pneumoniae strain endophthalmitis isolate 335]
ATGATAAATAACGTTGTTTTAGTAGGGCGACTTACAAGAGATGCCGAACTGAGATACACGCAATCTAATATTGCGGTTGC
TACGTTTACTCTTGCTGTAAACCGTCCATTTAAGAACGAGGCTGGAGAGCGTGAGGCTGATTTTATCAATTGCGTTATCT
GGAGACAGTTAGCTGAAAATCTTGCTAATTGGGCTAAAAAAGGCTCTCTTATCGGAGTTACAGGAGTAATTCAAACACGT
AGCTATGATAACCAGCAAGGTCAACGTGTTTATGTCACAGAAGTTGTTGCCAGTAATTTTCAACTGTTGGAAAGCCGTAA
CAGTCAGCAAAATAATCAAGGTCATCAAGACCATCATGGCGGTTATCAGCAGCAGGGCTACAGTAATCAAGGCAGTTCTT
TCCAAAATGGAAATAGTTACGGGCAACAAGGCAGTTTCGTTGAGGGGAACACAACAAATCTAGTTCCTGATTTCACCCGT
GATAACAATCCATTTGGCAGACCCACAAATCCATTGGATATTAGTGATGATGATTTACCGTTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

56.593

100

0.569

  ssbA Bacillus subtilis subsp. subtilis str. 168

51.075

100

0.525


Multiple sequence alignment