Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | C4N11_RS08035 | Genome accession | NZ_CP026670 |
| Coordinates | 1519513..1520058 (-) | Length | 181 a.a. |
| NCBI ID | WP_000609575.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain endophthalmitis isolate 335 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1487864..1541049 | 1519513..1520058 | within | 0 |
Gene organization within MGE regions
Location: 1487864..1541049
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C4N11_RS07850 (C4N11_07850) | - | 1487864..1488820 (-) | 957 | WP_000350453.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| C4N11_RS07855 (C4N11_07855) | - | 1488824..1489156 (-) | 333 | WP_001186206.1 | phage holin | - |
| C4N11_RS07860 (C4N11_07860) | - | 1489160..1489576 (-) | 417 | WP_000687454.1 | phage holin family protein | - |
| C4N11_RS07865 (C4N11_07865) | - | 1489586..1489855 (-) | 270 | WP_015968626.1 | hypothetical protein | - |
| C4N11_RS07870 (C4N11_07870) | - | 1489909..1491987 (-) | 2079 | WP_000159973.1 | DUF859 family phage minor structural protein | - |
| C4N11_RS07875 (C4N11_07875) | - | 1491998..1497025 (-) | 5028 | WP_000927607.1 | phage tail protein | - |
| C4N11_RS07880 (C4N11_07880) | - | 1497027..1498541 (-) | 1515 | WP_000161549.1 | distal tail protein Dit | - |
| C4N11_RS07885 (C4N11_07885) | - | 1498538..1501819 (-) | 3282 | WP_000763178.1 | tape measure protein | - |
| C4N11_RS07890 (C4N11_07890) | - | 1501812..1502381 (-) | 570 | WP_000062049.1 | Gp15 family bacteriophage protein | - |
| C4N11_RS07895 (C4N11_07895) | - | 1502394..1502882 (-) | 489 | WP_000129838.1 | hypothetical protein | - |
| C4N11_RS07900 (C4N11_07900) | - | 1502947..1503396 (-) | 450 | WP_000198230.1 | hypothetical protein | - |
| C4N11_RS07905 (C4N11_07905) | - | 1503393..1503800 (-) | 408 | WP_001208881.1 | minor capsid protein | - |
| C4N11_RS07910 (C4N11_07910) | - | 1503800..1504144 (-) | 345 | WP_001017359.1 | minor capsid protein | - |
| C4N11_RS07915 (C4N11_07915) | - | 1504144..1504515 (-) | 372 | WP_000565932.1 | putative minor capsid protein | - |
| C4N11_RS07920 (C4N11_07920) | - | 1504505..1504897 (-) | 393 | WP_000221834.1 | hypothetical protein | - |
| C4N11_RS07925 (C4N11_07925) | - | 1504940..1505173 (-) | 234 | WP_001240344.1 | hypothetical protein | - |
| C4N11_RS07930 (C4N11_07930) | - | 1505184..1506065 (-) | 882 | WP_001139818.1 | hypothetical protein | - |
| C4N11_RS07935 (C4N11_07935) | - | 1506083..1506646 (-) | 564 | WP_000896122.1 | phage scaffolding protein | - |
| C4N11_RS07940 (C4N11_07940) | - | 1506785..1507936 (-) | 1152 | WP_000730218.1 | phage minor capsid protein | - |
| C4N11_RS12215 | - | 1507979..1508152 (-) | 174 | WP_000169861.1 | hypothetical protein | - |
| C4N11_RS07945 (C4N11_07945) | - | 1508139..1509707 (-) | 1569 | WP_000051860.1 | phage portal protein | - |
| C4N11_RS07950 (C4N11_07950) | - | 1509720..1511030 (-) | 1311 | WP_000143806.1 | PBSX family phage terminase large subunit | - |
| C4N11_RS07955 (C4N11_07955) | - | 1511020..1511475 (-) | 456 | WP_001136857.1 | KGG domain-containing protein | - |
| C4N11_RS07960 (C4N11_07960) | - | 1511679..1512425 (-) | 747 | WP_000057536.1 | hypothetical protein | - |
| C4N11_RS07965 (C4N11_07965) | - | 1512406..1513500 (-) | 1095 | WP_000425577.1 | DUF4417 domain-containing protein | - |
| C4N11_RS07970 (C4N11_07970) | - | 1513566..1513958 (-) | 393 | WP_000162611.1 | hypothetical protein | - |
| C4N11_RS07975 (C4N11_07975) | - | 1513955..1514197 (-) | 243 | WP_001067626.1 | DUF3310 domain-containing protein | - |
| C4N11_RS07980 (C4N11_07980) | - | 1514257..1514676 (-) | 420 | WP_000612390.1 | YopX family protein | - |
| C4N11_RS12020 | - | 1514691..1514867 (-) | 177 | WP_158302876.1 | hypothetical protein | - |
| C4N11_RS07985 (C4N11_07985) | - | 1514864..1515151 (-) | 288 | WP_000194857.1 | hypothetical protein | - |
| C4N11_RS07990 (C4N11_07990) | - | 1515151..1515648 (-) | 498 | WP_001021764.1 | DUF1642 domain-containing protein | - |
| C4N11_RS07995 (C4N11_07995) | - | 1515650..1515967 (-) | 318 | WP_000969681.1 | hypothetical protein | - |
| C4N11_RS08000 (C4N11_08000) | - | 1516016..1516222 (-) | 207 | WP_000573750.1 | hypothetical protein | - |
| C4N11_RS08005 (C4N11_08005) | - | 1516224..1516625 (-) | 402 | WP_000667209.1 | hypothetical protein | - |
| C4N11_RS08010 (C4N11_08010) | - | 1516636..1516848 (-) | 213 | WP_001286809.1 | hypothetical protein | - |
| C4N11_RS08015 (C4N11_08015) | - | 1516865..1517602 (-) | 738 | WP_000206142.1 | hypothetical protein | - |
| C4N11_RS08020 (C4N11_08020) | - | 1517604..1518038 (-) | 435 | WP_000358623.1 | hypothetical protein | - |
| C4N11_RS08025 (C4N11_08025) | - | 1518092..1518295 (-) | 204 | WP_000161128.1 | hypothetical protein | - |
| C4N11_RS08030 (C4N11_08030) | - | 1518330..1519487 (-) | 1158 | WP_000670026.1 | DNA cytosine methyltransferase | - |
| C4N11_RS08035 (C4N11_08035) | ssb | 1519513..1520058 (-) | 546 | WP_000609575.1 | single-stranded DNA-binding protein | Machinery gene |
| C4N11_RS12220 | - | 1520048..1520224 (-) | 177 | WP_001203349.1 | hypothetical protein | - |
| C4N11_RS08040 (C4N11_08040) | - | 1520246..1521238 (-) | 993 | WP_000237811.1 | DUF1351 domain-containing protein | - |
| C4N11_RS08045 (C4N11_08045) | - | 1521241..1521948 (-) | 708 | WP_000774582.1 | ERF family protein | - |
| C4N11_RS08050 (C4N11_08050) | - | 1521954..1522406 (-) | 453 | WP_001134282.1 | hypothetical protein | - |
| C4N11_RS08055 (C4N11_08055) | - | 1522458..1522982 (-) | 525 | WP_000717373.1 | hypothetical protein | - |
| C4N11_RS08060 (C4N11_08060) | - | 1523063..1523329 (-) | 267 | WP_000450965.1 | hypothetical protein | - |
| C4N11_RS08065 (C4N11_08065) | - | 1523561..1523827 (-) | 267 | WP_000989839.1 | Rrf2 family transcriptional regulator | - |
| C4N11_RS08070 (C4N11_08070) | - | 1524002..1524193 (-) | 192 | WP_001112906.1 | hypothetical protein | - |
| C4N11_RS08075 (C4N11_08075) | - | 1524490..1524852 (+) | 363 | WP_000464163.1 | helix-turn-helix domain-containing protein | - |
| C4N11_RS08080 (C4N11_08080) | - | 1524874..1525254 (+) | 381 | WP_000136430.1 | ImmA/IrrE family metallo-endopeptidase | - |
| C4N11_RS08085 (C4N11_08085) | - | 1525268..1525618 (+) | 351 | WP_001020945.1 | hypothetical protein | - |
| C4N11_RS08090 (C4N11_08090) | - | 1525737..1526864 (+) | 1128 | WP_000266853.1 | site-specific integrase | - |
| C4N11_RS08095 (C4N11_08095) | whiA | 1526952..1527863 (-) | 912 | WP_000011276.1 | DNA-binding protein WhiA | - |
| C4N11_RS08100 (C4N11_08100) | - | 1527860..1528837 (-) | 978 | WP_001231086.1 | YvcK family protein | - |
| C4N11_RS08105 (C4N11_08105) | rapZ | 1528834..1529724 (-) | 891 | WP_000163035.1 | RNase adapter RapZ | - |
| C4N11_RS08110 (C4N11_08110) | - | 1529776..1530156 (-) | 381 | WP_001140412.1 | RidA family protein | - |
| C4N11_RS08115 (C4N11_08115) | yihA | 1530167..1530754 (-) | 588 | WP_000422605.1 | ribosome biogenesis GTP-binding protein YihA/YsxC | - |
| C4N11_RS08120 (C4N11_08120) | clpX | 1530763..1531995 (-) | 1233 | WP_000106354.1 | ATP-dependent Clp protease ATP-binding subunit ClpX | Regulator |
| C4N11_RS08125 (C4N11_08125) | - | 1532027..1532197 (-) | 171 | WP_000442276.1 | hypothetical protein | - |
| C4N11_RS08130 (C4N11_08130) | - | 1532197..1532703 (-) | 507 | WP_000162437.1 | dihydrofolate reductase | - |
| C4N11_RS08135 (C4N11_08135) | - | 1532833..1533351 (-) | 519 | WP_000229856.1 | DNA starvation/stationary phase protection protein | - |
| C4N11_RS08140 (C4N11_08140) | lytC | 1533849..1535354 (-) | 1506 | WP_012386833.1 | choline binding-anchored murein hydrolase LytC | - |
| C4N11_RS08145 (C4N11_08145) | tpiA | 1535392..1536150 (-) | 759 | WP_000087897.1 | triose-phosphate isomerase | - |
| C4N11_RS08150 (C4N11_08150) | - | 1536248..1536925 (-) | 678 | WP_000221614.1 | DnaD domain-containing protein | - |
| C4N11_RS08155 (C4N11_08155) | metA | 1536934..1537878 (-) | 945 | WP_001122712.1 | homoserine O-succinyltransferase | - |
| C4N11_RS08160 (C4N11_08160) | - | 1538060..1538572 (-) | 513 | WP_001049323.1 | adenine phosphoribosyltransferase | - |
| C4N11_RS08165 (C4N11_08165) | - | 1538660..1539418 (-) | 759 | WP_001287230.1 | class I SAM-dependent methyltransferase | - |
| C4N11_RS12025 | - | 1539626..1539796 (+) | 171 | WP_000403103.1 | hypothetical protein | - |
| C4N11_RS08170 (C4N11_08170) | - | 1539919..1541049 (-) | 1131 | WP_000229959.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 181 a.a. Molecular weight: 20230.07 Da Isoelectric Point: 5.1785
>NTDB_id=271440 C4N11_RS08035 WP_000609575.1 1519513..1520058(-) (ssb) [Streptococcus pneumoniae strain endophthalmitis isolate 335]
MINNVVLVGRLTRDAELRYTQSNIAVATFTLAVNRPFKNEAGEREADFINCVIWRQLAENLANWAKKGSLIGVTGVIQTR
SYDNQQGQRVYVTEVVASNFQLLESRNSQQNNQGHQDHHGGYQQQGYSNQGSSFQNGNSYGQQGSFVEGNTTNLVPDFTR
DNNPFGRPTNPLDISDDDLPF
MINNVVLVGRLTRDAELRYTQSNIAVATFTLAVNRPFKNEAGEREADFINCVIWRQLAENLANWAKKGSLIGVTGVIQTR
SYDNQQGQRVYVTEVVASNFQLLESRNSQQNNQGHQDHHGGYQQQGYSNQGSSFQNGNSYGQQGSFVEGNTTNLVPDFTR
DNNPFGRPTNPLDISDDDLPF
Nucleotide
Download Length: 546 bp
>NTDB_id=271440 C4N11_RS08035 WP_000609575.1 1519513..1520058(-) (ssb) [Streptococcus pneumoniae strain endophthalmitis isolate 335]
ATGATAAATAACGTTGTTTTAGTAGGGCGACTTACAAGAGATGCCGAACTGAGATACACGCAATCTAATATTGCGGTTGC
TACGTTTACTCTTGCTGTAAACCGTCCATTTAAGAACGAGGCTGGAGAGCGTGAGGCTGATTTTATCAATTGCGTTATCT
GGAGACAGTTAGCTGAAAATCTTGCTAATTGGGCTAAAAAAGGCTCTCTTATCGGAGTTACAGGAGTAATTCAAACACGT
AGCTATGATAACCAGCAAGGTCAACGTGTTTATGTCACAGAAGTTGTTGCCAGTAATTTTCAACTGTTGGAAAGCCGTAA
CAGTCAGCAAAATAATCAAGGTCATCAAGACCATCATGGCGGTTATCAGCAGCAGGGCTACAGTAATCAAGGCAGTTCTT
TCCAAAATGGAAATAGTTACGGGCAACAAGGCAGTTTCGTTGAGGGGAACACAACAAATCTAGTTCCTGATTTCACCCGT
GATAACAATCCATTTGGCAGACCCACAAATCCATTGGATATTAGTGATGATGATTTACCGTTTTAG
ATGATAAATAACGTTGTTTTAGTAGGGCGACTTACAAGAGATGCCGAACTGAGATACACGCAATCTAATATTGCGGTTGC
TACGTTTACTCTTGCTGTAAACCGTCCATTTAAGAACGAGGCTGGAGAGCGTGAGGCTGATTTTATCAATTGCGTTATCT
GGAGACAGTTAGCTGAAAATCTTGCTAATTGGGCTAAAAAAGGCTCTCTTATCGGAGTTACAGGAGTAATTCAAACACGT
AGCTATGATAACCAGCAAGGTCAACGTGTTTATGTCACAGAAGTTGTTGCCAGTAATTTTCAACTGTTGGAAAGCCGTAA
CAGTCAGCAAAATAATCAAGGTCATCAAGACCATCATGGCGGTTATCAGCAGCAGGGCTACAGTAATCAAGGCAGTTCTT
TCCAAAATGGAAATAGTTACGGGCAACAAGGCAGTTTCGTTGAGGGGAACACAACAAATCTAGTTCCTGATTTCACCCGT
GATAACAATCCATTTGGCAGACCCACAAATCCATTGGATATTAGTGATGATGATTTACCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.593 |
100 |
0.569 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.075 |
100 |
0.525 |