Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   DXY22_RS19375 Genome accession   NZ_CP031693
Coordinates   3761767..3761934 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   A8D470
Organism   Bacillus subtilis strain SRCM101393     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3756767..3766934
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DXY22_RS19345 (DXY22_03812) mrpE 3757160..3757636 (+) 477 WP_003228815.1 Na+/H+ antiporter subunit E -
  DXY22_RS19350 (DXY22_03813) mrpF 3757636..3757920 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  DXY22_RS19355 (DXY22_03814) mnhG 3757904..3758278 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  DXY22_RS19360 (DXY22_03815) yuxO 3758319..3758699 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  DXY22_RS19365 (DXY22_03816) comA 3758718..3759362 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  DXY22_RS19370 (DXY22_03817) comP 3759443..3761752 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  DXY22_RS19375 (DXY22_03818) comX 3761767..3761934 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  DXY22_RS19380 (DXY22_03819) comQ 3761922..3762821 (-) 900 WP_015251332.1 ComX modifying isoprenyl transferase ComQ Regulator
  DXY22_RS19385 (DXY22_03820) degQ 3763006..3763146 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  DXY22_RS19390 - 3763368..3763493 (+) 126 WP_003228793.1 hypothetical protein -
  DXY22_RS19395 (DXY22_03821) - 3763607..3763975 (+) 369 WP_014477834.1 hypothetical protein -
  DXY22_RS19400 (DXY22_03822) pdeH 3763951..3765180 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  DXY22_RS19405 (DXY22_03823) pncB 3765317..3766789 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=270602 DXY22_RS19375 WP_003242801.1 3761767..3761934(-) (comX) [Bacillus subtilis strain SRCM101393]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=270602 DXY22_RS19375 WP_003242801.1 3761767..3761934(-) (comX) [Bacillus subtilis strain SRCM101393]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTTCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A8D470

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment