Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   DXY22_RS19385 Genome accession   NZ_CP031693
Coordinates   3763006..3763146 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM101393     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3758006..3768146
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DXY22_RS19360 (DXY22_03815) yuxO 3758319..3758699 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  DXY22_RS19365 (DXY22_03816) comA 3758718..3759362 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  DXY22_RS19370 (DXY22_03817) comP 3759443..3761752 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  DXY22_RS19375 (DXY22_03818) comX 3761767..3761934 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  DXY22_RS19380 (DXY22_03819) comQ 3761922..3762821 (-) 900 WP_015251332.1 ComX modifying isoprenyl transferase ComQ Regulator
  DXY22_RS19385 (DXY22_03820) degQ 3763006..3763146 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  DXY22_RS19390 - 3763368..3763493 (+) 126 WP_003228793.1 hypothetical protein -
  DXY22_RS19395 (DXY22_03821) - 3763607..3763975 (+) 369 WP_014477834.1 hypothetical protein -
  DXY22_RS19400 (DXY22_03822) pdeH 3763951..3765180 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  DXY22_RS19405 (DXY22_03823) pncB 3765317..3766789 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  DXY22_RS19410 (DXY22_03824) pncA 3766805..3767356 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  DXY22_RS19415 (DXY22_03825) yueI 3767453..3767851 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=270604 DXY22_RS19385 WP_003220708.1 3763006..3763146(-) (degQ) [Bacillus subtilis strain SRCM101393]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=270604 DXY22_RS19385 WP_003220708.1 3763006..3763146(-) (degQ) [Bacillus subtilis strain SRCM101393]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1