Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   C3438_RS11495 Genome accession   NZ_CP026533
Coordinates   2226323..2226442 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain DKU_NT_04     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 2221323..2231442
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C3438_RS11480 (C3438_11480) - 2222935..2223618 (+) 684 WP_014416901.1 response regulator transcription factor -
  C3438_RS11485 (C3438_11485) - 2223605..2225032 (+) 1428 WP_088056326.1 HAMP domain-containing sensor histidine kinase -
  C3438_RS11490 (C3438_11490) rapC 2225191..2226339 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  C3438_RS11495 (C3438_11495) phrC 2226323..2226442 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  C3438_RS11500 (C3438_11500) - 2226592..2226687 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  C3438_RS11505 (C3438_11505) - 2226782..2228146 (-) 1365 WP_104843084.1 aspartate kinase -
  C3438_RS11510 (C3438_11510) ceuB 2228559..2229512 (+) 954 WP_104843085.1 ABC transporter permease Machinery gene
  C3438_RS11515 (C3438_11515) - 2229502..2230449 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  C3438_RS11520 (C3438_11520) - 2230443..2231201 (+) 759 WP_022552588.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=270164 C3438_RS11495 WP_003156334.1 2226323..2226442(+) (phrC) [Bacillus velezensis strain DKU_NT_04]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=270164 C3438_RS11495 WP_003156334.1 2226323..2226442(+) (phrC) [Bacillus velezensis strain DKU_NT_04]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment