Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   C3438_RS04715 Genome accession   NZ_CP026533
Coordinates   904272..904412 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain DKU_NT_04     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 899272..909412
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C3438_RS04690 (C3438_04690) - 899599..899982 (-) 384 WP_104842774.1 hotdog fold thioesterase -
  C3438_RS04695 (C3438_04695) comA 900004..900648 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  C3438_RS04700 (C3438_04700) comP 900729..903035 (-) 2307 WP_065180455.1 sensor histidine kinase Regulator
  C3438_RS04705 (C3438_04705) comX 903054..903230 (-) 177 WP_017419424.1 competence pheromone ComX -
  C3438_RS04710 (C3438_04710) - 903245..904141 (-) 897 WP_017419425.1 polyprenyl synthetase family protein -
  C3438_RS04715 (C3438_04715) degQ 904272..904412 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  C3438_RS04725 (C3438_04725) - 904877..905218 (+) 342 WP_014418765.1 hypothetical protein -
  C3438_RS04730 (C3438_04730) - 905225..906448 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  C3438_RS04735 (C3438_04735) - 906578..908044 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  C3438_RS04740 (C3438_04740) - 908062..908613 (-) 552 WP_025853916.1 isochorismatase family cysteine hydrolase -
  C3438_RS04745 (C3438_04745) - 908710..909108 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=270141 C3438_RS04715 WP_003152043.1 904272..904412(-) (degQ) [Bacillus velezensis strain DKU_NT_04]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=270141 C3438_RS04715 WP_003152043.1 904272..904412(-) (degQ) [Bacillus velezensis strain DKU_NT_04]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment