Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   C3438_RS01445 Genome accession   NZ_CP026533
Coordinates   294191..294364 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain DKU_NT_04     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 289191..299364
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C3438_RS01430 (C3438_01430) gcvT 290004..291104 (-) 1101 WP_058906182.1 glycine cleavage system aminomethyltransferase GcvT -
  C3438_RS01435 (C3438_01435) - 291528..293198 (+) 1671 WP_104842680.1 SNF2-related protein -
  C3438_RS01440 (C3438_01440) - 293220..294014 (+) 795 WP_104842681.1 YqhG family protein -
  C3438_RS01445 (C3438_01445) sinI 294191..294364 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  C3438_RS01450 (C3438_01450) sinR 294398..294733 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  C3438_RS01455 (C3438_01455) - 294781..295565 (-) 785 Protein_290 TasA family protein -
  C3438_RS01460 (C3438_01460) - 295630..296214 (-) 585 WP_012117977.1 signal peptidase I -
  C3438_RS01465 (C3438_01465) tapA 296186..296857 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  C3438_RS01470 (C3438_01470) - 297116..297445 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  C3438_RS01475 (C3438_01475) - 297486..297665 (-) 180 WP_003153093.1 YqzE family protein -
  C3438_RS01480 (C3438_01480) comGG 297722..298099 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  C3438_RS01485 (C3438_01485) comGF 298100..298495 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  C3438_RS01490 (C3438_01490) comGE 298509..298823 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  C3438_RS01495 (C3438_01495) comGD 298807..299244 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=270119 C3438_RS01445 WP_014418369.1 294191..294364(+) (sinI) [Bacillus velezensis strain DKU_NT_04]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=270119 C3438_RS01445 WP_014418369.1 294191..294364(+) (sinI) [Bacillus velezensis strain DKU_NT_04]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719


Multiple sequence alignment