Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | C3438_RS01445 | Genome accession | NZ_CP026533 |
| Coordinates | 294191..294364 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain DKU_NT_04 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 289191..299364
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C3438_RS01430 (C3438_01430) | gcvT | 290004..291104 (-) | 1101 | WP_058906182.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| C3438_RS01435 (C3438_01435) | - | 291528..293198 (+) | 1671 | WP_104842680.1 | SNF2-related protein | - |
| C3438_RS01440 (C3438_01440) | - | 293220..294014 (+) | 795 | WP_104842681.1 | YqhG family protein | - |
| C3438_RS01445 (C3438_01445) | sinI | 294191..294364 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| C3438_RS01450 (C3438_01450) | sinR | 294398..294733 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| C3438_RS01455 (C3438_01455) | - | 294781..295565 (-) | 785 | Protein_290 | TasA family protein | - |
| C3438_RS01460 (C3438_01460) | - | 295630..296214 (-) | 585 | WP_012117977.1 | signal peptidase I | - |
| C3438_RS01465 (C3438_01465) | tapA | 296186..296857 (-) | 672 | WP_025649852.1 | amyloid fiber anchoring/assembly protein TapA | - |
| C3438_RS01470 (C3438_01470) | - | 297116..297445 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| C3438_RS01475 (C3438_01475) | - | 297486..297665 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| C3438_RS01480 (C3438_01480) | comGG | 297722..298099 (-) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| C3438_RS01485 (C3438_01485) | comGF | 298100..298495 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| C3438_RS01490 (C3438_01490) | comGE | 298509..298823 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| C3438_RS01495 (C3438_01495) | comGD | 298807..299244 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=270119 C3438_RS01445 WP_014418369.1 294191..294364(+) (sinI) [Bacillus velezensis strain DKU_NT_04]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=270119 C3438_RS01445 WP_014418369.1 294191..294364(+) (sinI) [Bacillus velezensis strain DKU_NT_04]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |