Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   C3438_RS01490 Genome accession   NZ_CP026533
Coordinates   298509..298823 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain DKU_NT_04     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 293509..303823
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C3438_RS01445 (C3438_01445) sinI 294191..294364 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  C3438_RS01450 (C3438_01450) sinR 294398..294733 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  C3438_RS01455 (C3438_01455) - 294781..295565 (-) 785 Protein_290 TasA family protein -
  C3438_RS01460 (C3438_01460) - 295630..296214 (-) 585 WP_012117977.1 signal peptidase I -
  C3438_RS01465 (C3438_01465) tapA 296186..296857 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  C3438_RS01470 (C3438_01470) - 297116..297445 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  C3438_RS01475 (C3438_01475) - 297486..297665 (-) 180 WP_003153093.1 YqzE family protein -
  C3438_RS01480 (C3438_01480) comGG 297722..298099 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  C3438_RS01485 (C3438_01485) comGF 298100..298495 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  C3438_RS01490 (C3438_01490) comGE 298509..298823 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  C3438_RS01495 (C3438_01495) comGD 298807..299244 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  C3438_RS01500 (C3438_01500) comGC 299234..299500 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  C3438_RS01505 (C3438_01505) comGB 299547..300584 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  C3438_RS01510 (C3438_01510) comGA 300571..301641 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  C3438_RS01515 (C3438_01515) - 301833..302783 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=270122 C3438_RS01490 WP_017418140.1 298509..298823(-) (comGE) [Bacillus velezensis strain DKU_NT_04]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=270122 C3438_RS01490 WP_017418140.1 298509..298823(-) (comGE) [Bacillus velezensis strain DKU_NT_04]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment