Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BV11031_RS01490 Genome accession   NZ_CP026362
Coordinates   290958..291098 (+) Length   46 a.a.
NCBI ID   WP_010329910.1    Uniprot ID   A0AAP3FQF4
Organism   Bacillus vallismortis strain DSM 11031     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 285958..296098
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BV11031_RS01460 (BV11031_01465) - 286258..286656 (+) 399 WP_010329915.1 YueI family protein -
  BV11031_RS01465 (BV11031_01470) - 286753..287304 (+) 552 WP_010329914.1 isochorismatase family cysteine hydrolase -
  BV11031_RS01470 (BV11031_01475) - 287320..288792 (+) 1473 WP_010329913.1 nicotinate phosphoribosyltransferase -
  BV11031_RS01475 (BV11031_01480) pdeH 288925..290154 (+) 1230 WP_010329912.1 cyclic di-GMP phosphodiesterase -
  BV11031_RS01480 (BV11031_01485) - 290133..290498 (-) 366 WP_010329911.1 hypothetical protein -
  BV11031_RS01485 - 290611..290778 (-) 168 WP_128568229.1 hypothetical protein -
  BV11031_RS01490 (BV11031_01490) degQ 290958..291098 (+) 141 WP_010329910.1 degradation enzyme regulation protein DegQ Regulator
  BV11031_RS01495 (BV11031_01495) - 291229..292122 (+) 894 WP_240467595.1 polyprenyl synthetase family protein -
  BV11031_RS01500 (BV11031_01500) comX 292137..292313 (+) 177 WP_010329908.1 competence pheromone ComX -
  BV11031_RS01505 (BV11031_01505) comP 292333..294651 (+) 2319 WP_010329907.1 sensor histidine kinase Regulator
  BV11031_RS01510 (BV11031_01510) comA 294732..295376 (+) 645 WP_010329906.1 two-component system response regulator ComA Regulator
  BV11031_RS01515 (BV11031_01515) - 295395..295775 (+) 381 WP_010329905.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.39 Da        Isoelectric Point: 4.9432

>NTDB_id=268797 BV11031_RS01490 WP_010329910.1 290958..291098(+) (degQ) [Bacillus vallismortis strain DSM 11031]
MEQKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=268797 BV11031_RS01490 WP_010329910.1 290958..291098(+) (degQ) [Bacillus vallismortis strain DSM 11031]
ATGGAACAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTATGCTATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

97.826

100

0.978

Multiple sequence alignment