Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   C2H97_RS04060 Genome accession   NZ_CP026038
Coordinates   743486..743626 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis PY79 strain PK1_3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 738486..748626
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2H97_RS04035 (C2H97_04045) yuxO 738828..739208 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  C2H97_RS04040 (C2H97_04050) comA 739227..739871 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  C2H97_RS04045 (C2H97_04055) comP 739952..742252 (-) 2301 WP_120028527.1 histidine kinase Regulator
  C2H97_RS04050 (C2H97_04060) comX 742264..742428 (-) 165 WP_015384519.1 competence pheromone ComX -
  C2H97_RS04055 (C2H97_04065) - 742441..743301 (-) 861 WP_064671628.1 polyprenyl synthetase family protein -
  C2H97_RS04060 (C2H97_04070) degQ 743486..743626 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  C2H97_RS04065 - 743848..743973 (+) 126 WP_120028613.1 hypothetical protein -
  C2H97_RS04070 (C2H97_04075) - 744088..744456 (+) 369 WP_038828672.1 hypothetical protein -
  C2H97_RS04075 (C2H97_04080) pdeH 744432..745661 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  C2H97_RS04080 (C2H97_04085) pncB 745798..747270 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  C2H97_RS04085 (C2H97_04090) pncA 747286..747837 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  C2H97_RS04090 (C2H97_04095) yueI 747934..748332 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=265762 C2H97_RS04060 WP_003220708.1 743486..743626(-) (degQ) [Bacillus subtilis PY79 strain PK1_3]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=265762 C2H97_RS04060 WP_003220708.1 743486..743626(-) (degQ) [Bacillus subtilis PY79 strain PK1_3]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment