Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   C2H96_RS16295 Genome accession   NZ_CP026035
Coordinates   3204716..3204856 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain PK5_68     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3199716..3209856
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2H96_RS16265 (C2H96_16210) yueI 3200010..3200408 (+) 399 WP_014480710.1 YueI family protein -
  C2H96_RS16270 (C2H96_16215) pncA 3200505..3201056 (+) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  C2H96_RS16275 (C2H96_16220) pncB 3201072..3202544 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  C2H96_RS16280 (C2H96_16225) pdeH 3202681..3203910 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  C2H96_RS16285 (C2H96_16230) - 3203886..3204254 (-) 369 WP_038828672.1 hypothetical protein -
  C2H96_RS16290 - 3204369..3204494 (-) 126 WP_120028613.1 hypothetical protein -
  C2H96_RS16295 (C2H96_16235) degQ 3204716..3204856 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  C2H96_RS16300 (C2H96_16240) - 3205041..3205901 (+) 861 WP_064671628.1 polyprenyl synthetase family protein -
  C2H96_RS16305 (C2H96_16245) comX 3205914..3206078 (+) 165 WP_015384519.1 competence pheromone ComX -
  C2H96_RS16310 (C2H96_16250) comP 3206090..3208390 (+) 2301 WP_120028527.1 histidine kinase Regulator
  C2H96_RS16315 (C2H96_16255) comA 3208471..3209115 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  C2H96_RS16320 (C2H96_16260) yuxO 3209134..3209514 (+) 381 WP_014477831.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=265554 C2H96_RS16295 WP_003220708.1 3204716..3204856(+) (degQ) [Bacillus subtilis strain PK5_68]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=265554 C2H96_RS16295 WP_003220708.1 3204716..3204856(+) (degQ) [Bacillus subtilis strain PK5_68]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment