Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   C2H94_RS05345 Genome accession   NZ_CP026034
Coordinates   961199..961339 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain PK5_52     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 956199..966339
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2H94_RS05320 (C2H94_05285) yuxO 956550..956930 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  C2H94_RS05325 (C2H94_05290) comA 956949..957593 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  C2H94_RS05330 (C2H94_05295) - 957674..959970 (-) 2297 Protein_1036 histidine kinase -
  C2H94_RS05335 (C2H94_05300) comX 959978..960139 (-) 162 WP_049140565.1 competence pheromone ComX -
  C2H94_RS05340 (C2H94_05305) - 960154..961014 (-) 861 WP_032677058.1 polyprenyl synthetase family protein -
  C2H94_RS05345 (C2H94_05310) degQ 961199..961339 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  C2H94_RS05350 - 961561..961623 (+) 63 Protein_1040 hypothetical protein -
  C2H94_RS05355 (C2H94_05315) - 961802..962170 (+) 369 WP_017695529.1 hypothetical protein -
  C2H94_RS05360 (C2H94_05320) pdeH 962146..963375 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  C2H94_RS05365 (C2H94_05325) pncB 963512..964984 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  C2H94_RS05370 (C2H94_05330) pncA 965000..965551 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  C2H94_RS05375 (C2H94_05335) yueI 965648..966046 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=265451 C2H94_RS05345 WP_003220708.1 961199..961339(-) (degQ) [Bacillus subtilis strain PK5_52]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=265451 C2H94_RS05345 WP_003220708.1 961199..961339(-) (degQ) [Bacillus subtilis strain PK5_52]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment