Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   C2H94_RS01680 Genome accession   NZ_CP026034
Coordinates   286966..287139 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain PK5_52     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 281966..292139
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2H94_RS01665 (C2H94_01645) gcvT 282764..283852 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  C2H94_RS01670 (C2H94_01650) yqhH 284294..285967 (+) 1674 WP_038829735.1 SNF2-related protein -
  C2H94_RS01675 (C2H94_01655) yqhG 285988..286782 (+) 795 WP_032726154.1 YqhG family protein -
  C2H94_RS01680 (C2H94_01665) sinI 286966..287139 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  C2H94_RS01685 (C2H94_01670) sinR 287173..287508 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C2H94_RS01690 (C2H94_01675) tasA 287600..288385 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  C2H94_RS01695 (C2H94_01680) sipW 288450..289022 (-) 573 WP_003246088.1 signal peptidase I SipW -
  C2H94_RS01700 (C2H94_01685) tapA 289006..289767 (-) 762 WP_032726156.1 amyloid fiber anchoring/assembly protein TapA -
  C2H94_RS01705 (C2H94_01690) yqzG 290038..290364 (+) 327 WP_038829733.1 YqzG/YhdC family protein -
  C2H94_RS01710 (C2H94_01695) spoIIT 290406..290585 (-) 180 WP_014480252.1 YqzE family protein -
  C2H94_RS01715 (C2H94_01700) comGG 290657..291031 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  C2H94_RS01720 (C2H94_01705) comGF 291032..291415 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  C2H94_RS01725 (C2H94_01710) comGE 291441..291788 (-) 348 WP_063335293.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=265428 C2H94_RS01680 WP_014477323.1 286966..287139(+) (sinI) [Bacillus subtilis strain PK5_52]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=265428 C2H94_RS01680 WP_014477323.1 286966..287139(+) (sinI) [Bacillus subtilis strain PK5_52]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982

Multiple sequence alignment