Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   SPYM_RS00665 Genome accession   NC_009332
Coordinates   106473..106757 (+) Length   94 a.a.
NCBI ID   WP_041174183.1    Uniprot ID   -
Organism   Streptococcus pyogenes str. Manfredo     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 101473..111757
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPYM_RS00640 (SpyM50083) - 103419..103784 (+) 366 WP_002986560.1 DUF1033 family protein -
  SPYM_RS00645 (SpyM50084) comGA 103877..104815 (+) 939 WP_011888534.1 competence type IV pilus ATPase ComGA Machinery gene
  SPYM_RS00650 (SpyM50085) comGB 104751..105785 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  SPYM_RS00655 (SpyM50086) comGC 105787..106113 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  SPYM_RS00660 (SpyM50087) comGD 106088..106516 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  SPYM_RS00665 (SpyM50088) comGE 106473..106757 (+) 285 WP_041174183.1 competence type IV pilus minor pilin ComGE Machinery gene
  SPYM_RS00670 (SpyM50089) comGF 106750..107184 (+) 435 WP_002986542.1 competence type IV pilus minor pilin ComGF Machinery gene
  SPYM_RS00675 (SpyM50090) comGG 107168..107494 (+) 327 WP_002986539.1 competence type IV pilus minor pilin ComGG -
  SPYM_RS00680 (SpyM50091) comGH 107592..108545 (+) 954 WP_002987790.1 class I SAM-dependent methyltransferase Machinery gene
  SPYM_RS00685 (SpyM50092) - 108604..109800 (+) 1197 WP_011888536.1 acetate kinase -
  SPYM_RS00690 (SpyM50093) - 109987..110295 (+) 309 WP_011017251.1 hypothetical protein -
  SPYM_RS00695 (SpyM50094) proC 110378..111148 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10702.71 Da        Isoelectric Point: 8.9043

>NTDB_id=26440 SPYM_RS00665 WP_041174183.1 106473..106757(+) (comGE) [Streptococcus pyogenes str. Manfredo]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALMYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=26440 SPYM_RS00665 WP_041174183.1 106473..106757(+) (comGE) [Streptococcus pyogenes str. Manfredo]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAATGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAT
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment