Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   CYK59_RS03855 Genome accession   NZ_CP025476
Coordinates   704602..705114 (+) Length   170 a.a.
NCBI ID   WP_126133249.1    Uniprot ID   -
Organism   Latilactobacillus curvatus strain IRG2     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 693309..744598 704602..705114 within 0


Gene organization within MGE regions


Location: 693309..744598
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CYK59_RS03755 (CYK59_03765) - 693309..694523 (-) 1215 WP_126133231.1 tyrosine-type recombinase/integrase -
  CYK59_RS03760 (CYK59_03770) - 694635..696167 (-) 1533 WP_126133232.1 glucosyltransferase domain-containing protein -
  CYK59_RS03765 (CYK59_03775) - 696250..696651 (-) 402 WP_126133233.1 ImmA/IrrE family metallo-endopeptidase -
  CYK59_RS03770 (CYK59_03780) - 696657..696977 (-) 321 WP_126133234.1 helix-turn-helix domain-containing protein -
  CYK59_RS03775 (CYK59_03785) - 697232..697444 (+) 213 WP_126133235.1 transcriptional regulator -
  CYK59_RS10235 - 697458..697613 (+) 156 WP_164545991.1 hypothetical protein -
  CYK59_RS03780 (CYK59_03790) - 697603..697986 (-) 384 WP_164545992.1 DUF2513 domain-containing protein -
  CYK59_RS03785 (CYK59_03795) - 698027..698728 (+) 702 WP_126133237.1 Rha family transcriptional regulator -
  CYK59_RS03790 (CYK59_03800) - 698731..698916 (+) 186 WP_126133238.1 hypothetical protein -
  CYK59_RS03795 (CYK59_03805) - 698913..699194 (-) 282 WP_126133239.1 hypothetical protein -
  CYK59_RS03800 (CYK59_03810) - 699320..699517 (+) 198 WP_126133240.1 helix-turn-helix domain-containing protein -
  CYK59_RS03805 (CYK59_03815) - 699520..699801 (+) 282 WP_126133241.1 hypothetical protein -
  CYK59_RS03810 (CYK59_03820) - 699906..700112 (+) 207 WP_126133242.1 hypothetical protein -
  CYK59_RS03815 (CYK59_03825) - 700195..700554 (-) 360 WP_126133243.1 MarR family winged helix-turn-helix transcriptional regulator -
  CYK59_RS03820 (CYK59_03830) - 700761..701030 (+) 270 WP_126133244.1 hypothetical protein -
  CYK59_RS03825 (CYK59_03835) - 701033..701671 (+) 639 WP_126133245.1 ERF family protein -
  CYK59_RS03830 (CYK59_03840) - 701668..702354 (+) 687 WP_126133246.1 putative HNHc nuclease -
  CYK59_RS10420 - 702344..703039 (+) 696 WP_164545993.1 conserved phage C-terminal domain-containing protein -
  CYK59_RS03840 (CYK59_03850) - 703152..703856 (+) 705 WP_241231960.1 ATP-binding protein -
  CYK59_RS03845 (CYK59_03855) - 703965..704390 (+) 426 WP_126133247.1 RusA family crossover junction endodeoxyribonuclease -
  CYK59_RS03850 (CYK59_03860) - 704368..704589 (+) 222 WP_126133248.1 hypothetical protein -
  CYK59_RS03855 (CYK59_03865) ssb 704602..705114 (+) 513 WP_126133249.1 single-stranded DNA-binding protein Machinery gene
  CYK59_RS03860 (CYK59_03870) - 705126..705458 (+) 333 WP_126133250.1 hypothetical protein -
  CYK59_RS03865 (CYK59_03875) - 705461..705652 (+) 192 WP_126133251.1 hypothetical protein -
  CYK59_RS10245 - 706078..706230 (+) 153 WP_164545994.1 hypothetical protein -
  CYK59_RS03870 (CYK59_03880) - 706308..706739 (+) 432 WP_126133252.1 ArpU family phage packaging/lysis transcriptional regulator -
  CYK59_RS03880 (CYK59_03890) - 707124..707645 (+) 522 WP_126133253.1 hypothetical protein -
  CYK59_RS03885 (CYK59_03895) - 707629..707931 (+) 303 WP_126133254.1 hypothetical protein -
  CYK59_RS10545 - 708029..708157 (+) 129 WP_004271280.1 hypothetical protein -
  CYK59_RS03890 (CYK59_03900) - 708436..708747 (+) 312 WP_076632024.1 bacteriocin immunity protein -
  CYK59_RS03895 (CYK59_03905) - 709132..709386 (+) 255 WP_126133255.1 hypothetical protein -
  CYK59_RS10645 (CYK59_03910) - 709370..710152 (+) 783 Protein_729 HNH endonuclease -
  CYK59_RS03905 (CYK59_03915) - 710310..710756 (+) 447 WP_126133256.1 P27 family phage terminase small subunit -
  CYK59_RS03910 (CYK59_03920) - 710771..712456 (+) 1686 WP_126133598.1 terminase large subunit -
  CYK59_RS03915 (CYK59_03930) - 712681..713907 (+) 1227 WP_126133257.1 phage portal protein -
  CYK59_RS03920 (CYK59_03935) - 713864..714493 (+) 630 WP_126133258.1 HK97 family phage prohead protease -
  CYK59_RS03925 (CYK59_03940) - 714542..715747 (+) 1206 WP_126133259.1 phage major capsid protein -
  CYK59_RS03930 (CYK59_03945) - 715867..716196 (+) 330 WP_126133260.1 head-tail connector protein -
  CYK59_RS03935 (CYK59_03950) - 716183..716518 (+) 336 WP_164545995.1 phage head closure protein -
  CYK59_RS03940 (CYK59_03955) - 716515..716877 (+) 363 WP_126133261.1 HK97-gp10 family putative phage morphogenesis protein -
  CYK59_RS03945 (CYK59_03960) - 716870..717292 (+) 423 WP_126133262.1 hypothetical protein -
  CYK59_RS03950 (CYK59_03965) - 717279..717848 (+) 570 WP_126133263.1 major tail protein -
  CYK59_RS03955 (CYK59_03970) gpG 717939..718241 (+) 303 WP_126133264.1 phage tail assembly chaperone G -
  CYK59_RS03960 (CYK59_03975) - 718462..722793 (+) 4332 WP_126133265.1 phage tail tape measure protein -
  CYK59_RS03965 (CYK59_03980) - 722793..724244 (+) 1452 WP_126133266.1 distal tail protein Dit -
  CYK59_RS03970 (CYK59_03990) - 724413..725069 (-) 657 WP_126133267.1 hypothetical protein -
  CYK59_RS03975 (CYK59_03995) - 725129..730159 (+) 5031 WP_126133268.1 phage tail spike protein -
  CYK59_RS03980 (CYK59_04000) - 730172..730438 (+) 267 WP_126133269.1 hypothetical protein -
  CYK59_RS03985 (CYK59_04005) - 730445..730702 (+) 258 WP_126133270.1 hemolysin XhlA family protein -
  CYK59_RS03990 (CYK59_04010) - 730709..730918 (+) 210 WP_096584523.1 phage holin -
  CYK59_RS03995 (CYK59_04015) - 730915..731823 (+) 909 WP_126133271.1 SH3 domain-containing protein -
  CYK59_RS10250 - 732088..732252 (+) 165 WP_164545996.1 hypothetical protein -
  CYK59_RS04000 (CYK59_04020) - 732254..732868 (+) 615 WP_126133272.1 GNAT family N-acetyltransferase -
  CYK59_RS04005 (CYK59_04025) - 732910..733449 (-) 540 WP_126133273.1 helix-turn-helix transcriptional regulator -
  CYK59_RS04010 (CYK59_04030) - 733463..733897 (-) 435 WP_126133274.1 hypothetical protein -
  CYK59_RS04015 (CYK59_04035) - 734020..734475 (-) 456 WP_126133275.1 hypothetical protein -
  CYK59_RS04020 (CYK59_04040) - 734478..734738 (-) 261 WP_126133276.1 hypothetical protein -
  CYK59_RS10255 - 734757..734930 (-) 174 WP_164545997.1 hypothetical protein -
  CYK59_RS04025 (CYK59_04045) - 735197..735442 (+) 246 WP_004271157.1 hypothetical protein -
  CYK59_RS04030 (CYK59_04050) ybaK 735501..736007 (-) 507 WP_076800120.1 Cys-tRNA(Pro) deacylase -
  CYK59_RS10260 - 736121..736294 (+) 174 WP_004271151.1 hypothetical protein -
  CYK59_RS04035 (CYK59_04055) - 736356..736745 (+) 390 WP_076800122.1 hypothetical protein -
  CYK59_RS04040 (CYK59_04060) - 736896..737390 (+) 495 WP_035186990.1 DUF3013 family protein -
  CYK59_RS04045 (CYK59_04065) prmA 737421..738368 (+) 948 WP_076800126.1 50S ribosomal protein L11 methyltransferase -
  CYK59_RS04050 (CYK59_04070) - 738381..739136 (+) 756 WP_126133277.1 16S rRNA (uracil(1498)-N(3))-methyltransferase -
  CYK59_RS04055 (CYK59_04075) - 739173..739514 (+) 342 WP_004271163.1 hypothetical protein -
  CYK59_RS04060 (CYK59_04080) - 739604..741835 (+) 2232 WP_089556863.1 RelA/SpoT family protein -
  CYK59_RS04065 (CYK59_04085) dtd 741848..742297 (+) 450 WP_039099315.1 D-aminoacyl-tRNA deacylase -
  CYK59_RS04070 (CYK59_04090) - 742301..742927 (+) 627 WP_076787717.1 HAD-IA family hydrolase -
  CYK59_RS04075 (CYK59_04095) - 742976..743326 (-) 351 WP_126133278.1 DUF3397 family protein -
  CYK59_RS04080 (CYK59_04100) - 743454..743576 (+) 123 WP_004270707.1 DUF4044 domain-containing protein -
  CYK59_RS04085 (CYK59_04105) - 743668..744598 (-) 931 Protein_769 IS30-like element ISLpl1 family transposase -

Sequence


Protein


Download         Length: 170 a.a.        Molecular weight: 18601.12 Da        Isoelectric Point: 5.1661

>NTDB_id=261899 CYK59_RS03855 WP_126133249.1 704602..705114(+) (ssb) [Latilactobacillus curvatus strain IRG2]
MINRVVLVGRLTKDPELKYTSSGTAVGTFSLAVNRQFTNSNGDREADFINCVIWRKSAENFANFTHKGSLVGIDGRLQTR
NYENQQGQRVYVTEVVVDNFSLLESRTTTEQRQGDGASQNFNSNQSNGSQQSGFTSHQQSGNPSAANNTQAGPFANNGQA
IDISDDDLPF

Nucleotide


Download         Length: 513 bp        

>NTDB_id=261899 CYK59_RS03855 WP_126133249.1 704602..705114(+) (ssb) [Latilactobacillus curvatus strain IRG2]
ATGATTAATAGAGTTGTATTAGTTGGACGATTGACAAAAGACCCAGAACTTAAATATACGTCATCAGGCACAGCGGTTGG
GACGTTTAGCTTAGCTGTTAACCGCCAGTTCACAAATTCCAATGGTGATCGCGAAGCGGACTTTATCAACTGTGTCATCT
GGCGTAAATCAGCGGAAAACTTCGCAAACTTCACCCACAAAGGTTCACTAGTCGGGATTGATGGACGTCTGCAAACGAGA
AACTATGAAAACCAACAAGGTCAACGGGTATACGTAACCGAAGTGGTCGTTGATAACTTCTCATTGCTAGAATCACGGAC
AACAACGGAGCAGCGGCAAGGGGATGGCGCAAGCCAAAACTTTAACAGCAATCAAAGCAACGGTAGCCAACAATCTGGAT
TTACCAGCCATCAACAATCGGGTAATCCATCAGCTGCAAATAACACTCAAGCTGGTCCATTTGCAAATAATGGTCAAGCA
ATTGATATTTCAGATGACGATTTGCCATTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

91.765

100

0.918

  ssbA Bacillus subtilis subsp. subtilis str. 168

55.429

100

0.571


Multiple sequence alignment