Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   CXL14_RS08310 Genome accession   NZ_CP025258
Coordinates   1642158..1642298 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus sp. SJ-10     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1637158..1647298
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CXL14_RS08280 - 1637461..1637859 (+) 399 WP_003152031.1 DUF1694 domain-containing protein -
  CXL14_RS08285 - 1637956..1638507 (+) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  CXL14_RS08290 - 1638525..1639991 (+) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  CXL14_RS08295 - 1640121..1641344 (+) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  CXL14_RS08300 - 1641351..1641692 (-) 342 WP_014418765.1 hypothetical protein -
  CXL14_RS08310 degQ 1642158..1642298 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  CXL14_RS08315 - 1642429..1643355 (+) 927 WP_014721741.1 polyprenyl synthetase family protein -
  CXL14_RS08320 comX 1643355..1643525 (+) 171 WP_032863917.1 competence pheromone ComX -
  CXL14_RS08325 comP 1643503..1645854 (+) 2352 WP_269800792.1 histidine kinase Regulator
  CXL14_RS08330 comA 1645935..1646579 (+) 645 WP_014418762.1 response regulator transcription factor Regulator
  CXL14_RS08335 - 1646601..1646984 (+) 384 WP_014418761.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=259542 CXL14_RS08310 WP_003152043.1 1642158..1642298(+) (degQ) [Bacillus sp. SJ-10]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=259542 CXL14_RS08310 WP_003152043.1 1642158..1642298(+) (degQ) [Bacillus sp. SJ-10]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment