Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BVQ_RS12995 | Genome accession | NZ_CP025079 |
| Coordinates | 2626360..2626533 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain QST713 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2621360..2631533
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BVQ_RS12980 (BVQ_12970) | gcvT | 2622173..2623273 (-) | 1101 | WP_053573200.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BVQ_RS12985 (BVQ_12975) | - | 2623697..2625367 (+) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| BVQ_RS12990 (BVQ_12980) | - | 2625389..2626183 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| BVQ_RS12995 (BVQ_12985) | sinI | 2626360..2626533 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| BVQ_RS13000 (BVQ_12990) | sinR | 2626567..2626902 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BVQ_RS13005 (BVQ_12995) | tasA | 2626950..2627735 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| BVQ_RS13010 (BVQ_13000) | sipW | 2627800..2628384 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| BVQ_RS13015 (BVQ_13005) | tapA | 2628356..2629027 (-) | 672 | WP_053573199.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BVQ_RS13020 (BVQ_13010) | - | 2629286..2629615 (+) | 330 | WP_039254490.1 | DUF3889 domain-containing protein | - |
| BVQ_RS13025 (BVQ_13015) | - | 2629655..2629834 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BVQ_RS13030 (BVQ_13020) | comGG | 2629891..2630268 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BVQ_RS13035 (BVQ_13025) | comGF | 2630269..2630769 (-) | 501 | WP_256052909.1 | competence type IV pilus minor pilin ComGF | - |
| BVQ_RS13040 (BVQ_13030) | comGE | 2630678..2630992 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| BVQ_RS13045 (BVQ_13035) | comGD | 2630976..2631413 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=258206 BVQ_RS12995 WP_003153105.1 2626360..2626533(+) (sinI) [Bacillus velezensis strain QST713]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=258206 BVQ_RS12995 WP_003153105.1 2626360..2626533(+) (sinI) [Bacillus velezensis strain QST713]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |