Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   CV725_RS07595 Genome accession   NZ_CP024951
Coordinates   1555671..1555784 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori B128     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1550671..1560784
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CV725_RS07575 (CV725_07595) - 1551337..1552749 (-) 1413 WP_001861341.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  CV725_RS07580 (CV725_07600) comB10 1552819..1553955 (-) 1137 WP_001045869.1 DNA type IV secretion system protein ComB10 Machinery gene
  CV725_RS07585 (CV725_07605) comB9 1553948..1554931 (-) 984 WP_001861340.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  CV725_RS07590 (CV725_07610) comB8 1554931..1555674 (-) 744 WP_000660520.1 virB8 family protein Machinery gene
  CV725_RS07595 (CV725_07615) comB7 1555671..1555784 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  CV725_RS07600 (CV725_07620) comB6 1555800..1556855 (-) 1056 WP_000786677.1 P-type conjugative transfer protein TrbL Machinery gene
  CV725_RS07605 (CV725_07625) - 1556863..1557858 (-) 996 WP_000468428.1 PDZ domain-containing protein -
  CV725_RS07610 (CV725_07630) - 1557858..1558160 (-) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  CV725_RS07615 (CV725_07635) panD 1558163..1558516 (-) 354 WP_000142236.1 aspartate 1-decarboxylase -
  CV725_RS07620 (CV725_07640) - 1558506..1560731 (-) 2226 WP_001051506.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=256648 CV725_RS07595 WP_001217873.1 1555671..1555784(-) (comB7) [Helicobacter pylori B128]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=256648 CV725_RS07595 WP_001217873.1 1555671..1555784(-) (comB7) [Helicobacter pylori B128]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1

Multiple sequence alignment