Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   CVD07_RS14965 Genome accession   NZ_CP024897
Coordinates   3029676..3029816 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain CN026     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3024676..3034816
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CVD07_RS14940 (CVD07_14995) - 3025016..3025399 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  CVD07_RS14945 (CVD07_15000) comA 3025421..3026065 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  CVD07_RS14950 (CVD07_15005) comP 3026146..3028437 (-) 2292 WP_100261980.1 histidine kinase Regulator
  CVD07_RS14955 (CVD07_15010) comX 3028449..3028613 (-) 165 WP_007613432.1 competence pheromone ComX -
  CVD07_RS14960 (CVD07_15015) - 3028613..3029491 (-) 879 WP_032860494.1 polyprenyl synthetase family protein -
  CVD07_RS14965 (CVD07_15020) degQ 3029676..3029816 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  CVD07_RS14975 (CVD07_15030) - 3030282..3030623 (+) 342 WP_014418765.1 hypothetical protein -
  CVD07_RS14980 (CVD07_15035) - 3030630..3031853 (-) 1224 WP_029973798.1 EAL and HDOD domain-containing protein -
  CVD07_RS14985 (CVD07_15040) - 3031983..3033449 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  CVD07_RS14990 (CVD07_15045) - 3033467..3034018 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  CVD07_RS14995 (CVD07_15050) - 3034115..3034513 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=256272 CVD07_RS14965 WP_003152043.1 3029676..3029816(-) (degQ) [Bacillus velezensis strain CN026]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=256272 CVD07_RS14965 WP_003152043.1 3029676..3029816(-) (degQ) [Bacillus velezensis strain CN026]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment