Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   CVD07_RS11940 Genome accession   NZ_CP024897
Coordinates   2459286..2459723 (-) Length   145 a.a.
NCBI ID   WP_095061019.1    Uniprot ID   A0AAP4DGY0
Organism   Bacillus velezensis strain CN026     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2454286..2464723
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CVD07_RS11890 (CVD07_11935) sinI 2454669..2454842 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  CVD07_RS11895 (CVD07_11940) sinR 2454876..2455211 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CVD07_RS11900 (CVD07_11945) tasA 2455259..2456044 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  CVD07_RS11905 (CVD07_11950) sipW 2456109..2456693 (-) 585 WP_012117977.1 signal peptidase I SipW -
  CVD07_RS11910 (CVD07_11955) tapA 2456665..2457336 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  CVD07_RS11915 (CVD07_11960) - 2457595..2457924 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  CVD07_RS11920 (CVD07_11965) - 2457965..2458144 (-) 180 WP_003153093.1 YqzE family protein -
  CVD07_RS11925 (CVD07_11970) comGG 2458201..2458578 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  CVD07_RS11930 (CVD07_11975) comGF 2458579..2458974 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  CVD07_RS11935 (CVD07_11980) comGE 2458988..2459302 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  CVD07_RS11940 (CVD07_11985) comGD 2459286..2459723 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene
  CVD07_RS11945 (CVD07_11990) comGC 2459713..2460021 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  CVD07_RS11950 (CVD07_11995) comGB 2460026..2461063 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  CVD07_RS11955 (CVD07_12000) comGA 2461050..2462120 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  CVD07_RS11960 (CVD07_12005) - 2462313..2463263 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -
  CVD07_RS11965 (CVD07_12010) - 2463409..2464710 (+) 1302 WP_029973873.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16282.81 Da        Isoelectric Point: 10.1850

>NTDB_id=256254 CVD07_RS11940 WP_095061019.1 2459286..2459723(-) (comGD) [Bacillus velezensis strain CN026]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLVVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=256254 CVD07_RS11940 WP_095061019.1 2459286..2459723(-) (comGD) [Bacillus velezensis strain CN026]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGTCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

54.795

100

0.552


Multiple sequence alignment