Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | CVD07_RS11890 | Genome accession | NZ_CP024897 |
| Coordinates | 2454669..2454842 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain CN026 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2449669..2459842
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CVD07_RS11875 (CVD07_11920) | gcvT | 2450482..2451582 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| CVD07_RS11880 (CVD07_11925) | - | 2452006..2453676 (+) | 1671 | WP_021494309.1 | SNF2-related protein | - |
| CVD07_RS11885 (CVD07_11930) | - | 2453698..2454492 (+) | 795 | WP_100261894.1 | YqhG family protein | - |
| CVD07_RS11890 (CVD07_11935) | sinI | 2454669..2454842 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| CVD07_RS11895 (CVD07_11940) | sinR | 2454876..2455211 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| CVD07_RS11900 (CVD07_11945) | tasA | 2455259..2456044 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| CVD07_RS11905 (CVD07_11950) | sipW | 2456109..2456693 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| CVD07_RS11910 (CVD07_11955) | tapA | 2456665..2457336 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| CVD07_RS11915 (CVD07_11960) | - | 2457595..2457924 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| CVD07_RS11920 (CVD07_11965) | - | 2457965..2458144 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| CVD07_RS11925 (CVD07_11970) | comGG | 2458201..2458578 (-) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| CVD07_RS11930 (CVD07_11975) | comGF | 2458579..2458974 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| CVD07_RS11935 (CVD07_11980) | comGE | 2458988..2459302 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| CVD07_RS11940 (CVD07_11985) | comGD | 2459286..2459723 (-) | 438 | WP_095061019.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=256250 CVD07_RS11890 WP_014418369.1 2454669..2454842(+) (sinI) [Bacillus velezensis strain CN026]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=256250 CVD07_RS11890 WP_014418369.1 2454669..2454842(+) (sinI) [Bacillus velezensis strain CN026]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |