Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   CVD07_RS11890 Genome accession   NZ_CP024897
Coordinates   2454669..2454842 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain CN026     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2449669..2459842
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CVD07_RS11875 (CVD07_11920) gcvT 2450482..2451582 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  CVD07_RS11880 (CVD07_11925) - 2452006..2453676 (+) 1671 WP_021494309.1 SNF2-related protein -
  CVD07_RS11885 (CVD07_11930) - 2453698..2454492 (+) 795 WP_100261894.1 YqhG family protein -
  CVD07_RS11890 (CVD07_11935) sinI 2454669..2454842 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  CVD07_RS11895 (CVD07_11940) sinR 2454876..2455211 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CVD07_RS11900 (CVD07_11945) tasA 2455259..2456044 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  CVD07_RS11905 (CVD07_11950) sipW 2456109..2456693 (-) 585 WP_012117977.1 signal peptidase I SipW -
  CVD07_RS11910 (CVD07_11955) tapA 2456665..2457336 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  CVD07_RS11915 (CVD07_11960) - 2457595..2457924 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  CVD07_RS11920 (CVD07_11965) - 2457965..2458144 (-) 180 WP_003153093.1 YqzE family protein -
  CVD07_RS11925 (CVD07_11970) comGG 2458201..2458578 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  CVD07_RS11930 (CVD07_11975) comGF 2458579..2458974 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  CVD07_RS11935 (CVD07_11980) comGE 2458988..2459302 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  CVD07_RS11940 (CVD07_11985) comGD 2459286..2459723 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=256250 CVD07_RS11890 WP_014418369.1 2454669..2454842(+) (sinI) [Bacillus velezensis strain CN026]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=256250 CVD07_RS11890 WP_014418369.1 2454669..2454842(+) (sinI) [Bacillus velezensis strain CN026]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719


Multiple sequence alignment