Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | CUB85_RS15700 | Genome accession | NZ_CP024797 |
| Coordinates | 3144243..3144383 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain TJ02 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3139243..3149383
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CUB85_RS15675 | - | 3139590..3139973 (-) | 384 | WP_012118312.1 | hotdog fold thioesterase | - |
| CUB85_RS15680 | comA | 3139995..3140639 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| CUB85_RS15685 | - | 3140720..3143019 (-) | 2300 | Protein_3004 | histidine kinase | - |
| CUB85_RS15690 | comX | 3143033..3143206 (-) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| CUB85_RS15695 | - | 3143175..3144035 (-) | 861 | WP_157774448.1 | polyprenyl synthetase family protein | - |
| CUB85_RS15700 | degQ | 3144243..3144383 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| CUB85_RS15710 | - | 3144846..3145187 (+) | 342 | WP_007408677.1 | hypothetical protein | - |
| CUB85_RS15715 | - | 3145194..3146417 (-) | 1224 | WP_007408678.1 | EAL and HDOD domain-containing protein | - |
| CUB85_RS15720 | - | 3146547..3148013 (-) | 1467 | WP_015418109.1 | nicotinate phosphoribosyltransferase | - |
| CUB85_RS15725 | - | 3148031..3148582 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| CUB85_RS15730 | - | 3148679..3149077 (-) | 399 | WP_015240486.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=255521 CUB85_RS15700 WP_003152043.1 3144243..3144383(-) (degQ) [Bacillus velezensis strain TJ02]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=255521 CUB85_RS15700 WP_003152043.1 3144243..3144383(-) (degQ) [Bacillus velezensis strain TJ02]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |