Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   CUB85_RS15700 Genome accession   NZ_CP024797
Coordinates   3144243..3144383 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain TJ02     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3139243..3149383
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CUB85_RS15675 - 3139590..3139973 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  CUB85_RS15680 comA 3139995..3140639 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  CUB85_RS15685 - 3140720..3143019 (-) 2300 Protein_3004 histidine kinase -
  CUB85_RS15690 comX 3143033..3143206 (-) 174 WP_012118314.1 competence pheromone ComX -
  CUB85_RS15695 - 3143175..3144035 (-) 861 WP_157774448.1 polyprenyl synthetase family protein -
  CUB85_RS15700 degQ 3144243..3144383 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  CUB85_RS15710 - 3144846..3145187 (+) 342 WP_007408677.1 hypothetical protein -
  CUB85_RS15715 - 3145194..3146417 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  CUB85_RS15720 - 3146547..3148013 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  CUB85_RS15725 - 3148031..3148582 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  CUB85_RS15730 - 3148679..3149077 (-) 399 WP_015240486.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=255521 CUB85_RS15700 WP_003152043.1 3144243..3144383(-) (degQ) [Bacillus velezensis strain TJ02]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=255521 CUB85_RS15700 WP_003152043.1 3144243..3144383(-) (degQ) [Bacillus velezensis strain TJ02]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment