Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   DJ572_RS12150 Genome accession   NZ_CP029461
Coordinates   2354301..2354474 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain QB61     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2349301..2359474
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DJ572_RS12135 (DJ572_12095) gcvT 2350101..2351189 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  DJ572_RS12140 (DJ572_12100) hepAA 2351630..2353303 (+) 1674 WP_029726726.1 SNF2-related protein -
  DJ572_RS12145 (DJ572_12105) yqhG 2353324..2354118 (+) 795 WP_015714249.1 YqhG family protein -
  DJ572_RS12150 (DJ572_12110) sinI 2354301..2354474 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  DJ572_RS12155 (DJ572_12115) sinR 2354508..2354843 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  DJ572_RS12160 (DJ572_12120) tasA 2354936..2355721 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  DJ572_RS12165 (DJ572_12125) sipW 2355785..2356357 (-) 573 WP_003230181.1 signal peptidase I SipW -
  DJ572_RS12170 (DJ572_12130) tapA 2356341..2357102 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  DJ572_RS12175 (DJ572_12135) yqzG 2357374..2357700 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  DJ572_RS12180 (DJ572_12140) spoIITA 2357742..2357921 (-) 180 WP_029726723.1 YqzE family protein -
  DJ572_RS12185 (DJ572_12145) comGG 2357993..2358367 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  DJ572_RS12190 (DJ572_12150) comGF 2358368..2358751 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  DJ572_RS12195 (DJ572_12155) comGE 2358777..2359124 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=253382 DJ572_RS12150 WP_003230187.1 2354301..2354474(+) (sinI) [Bacillus subtilis strain QB61]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=253382 DJ572_RS12150 WP_003230187.1 2354301..2354474(+) (sinI) [Bacillus subtilis strain QB61]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1