Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   DJ572_RS12190 Genome accession   NZ_CP029461
Coordinates   2358368..2358751 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain QB61     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2353368..2363751
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DJ572_RS12150 (DJ572_12110) sinI 2354301..2354474 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  DJ572_RS12155 (DJ572_12115) sinR 2354508..2354843 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  DJ572_RS12160 (DJ572_12120) tasA 2354936..2355721 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  DJ572_RS12165 (DJ572_12125) sipW 2355785..2356357 (-) 573 WP_003230181.1 signal peptidase I SipW -
  DJ572_RS12170 (DJ572_12130) tapA 2356341..2357102 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  DJ572_RS12175 (DJ572_12135) yqzG 2357374..2357700 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  DJ572_RS12180 (DJ572_12140) spoIITA 2357742..2357921 (-) 180 WP_029726723.1 YqzE family protein -
  DJ572_RS12185 (DJ572_12145) comGG 2357993..2358367 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  DJ572_RS12190 (DJ572_12150) comGF 2358368..2358751 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  DJ572_RS12195 (DJ572_12155) comGE 2358777..2359124 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  DJ572_RS12200 (DJ572_12160) comGD 2359108..2359539 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  DJ572_RS12205 (DJ572_12165) comGC 2359529..2359825 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  DJ572_RS12210 (DJ572_12170) comGB 2359839..2360876 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  DJ572_RS12215 (DJ572_12175) comGA 2360863..2361933 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  DJ572_RS12220 (DJ572_12180) - 2362146..2362343 (-) 198 WP_029726717.1 hypothetical protein -
  DJ572_RS12225 (DJ572_12185) corA 2362345..2363298 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=253385 DJ572_RS12190 WP_029726721.1 2358368..2358751(-) (comGF) [Bacillus subtilis strain QB61]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=253385 DJ572_RS12190 WP_029726721.1 2358368..2358751(-) (comGF) [Bacillus subtilis strain QB61]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969


Multiple sequence alignment