Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   CQJ38_RS01920 Genome accession   NZ_CP023748
Coordinates   382505..382624 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain LABIM40     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 377505..387624
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CQJ38_RS01905 (CQJ38_01905) - 379117..379800 (+) 684 WP_063096183.1 response regulator transcription factor -
  CQJ38_RS01910 (CQJ38_01910) - 379787..381220 (+) 1434 WP_162992601.1 sensor histidine kinase -
  CQJ38_RS01915 (CQJ38_01915) rapC 381373..382521 (+) 1149 WP_098080978.1 Rap family tetratricopeptide repeat protein Regulator
  CQJ38_RS01920 (CQJ38_01920) phrC 382505..382624 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  CQJ38_RS01925 (CQJ38_01925) - 382773..382883 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  CQJ38_RS01930 (CQJ38_01930) - 382963..384327 (-) 1365 WP_080130839.1 aspartate kinase -
  CQJ38_RS01935 (CQJ38_01935) ceuB 384741..385694 (+) 954 WP_059366593.1 ABC transporter permease Machinery gene
  CQJ38_RS01940 (CQJ38_01940) - 385684..386631 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  CQJ38_RS01945 (CQJ38_01945) - 386625..387383 (+) 759 WP_063096189.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=249660 CQJ38_RS01920 WP_003156334.1 382505..382624(+) (phrC) [Bacillus velezensis strain LABIM40]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=249660 CQJ38_RS01920 WP_003156334.1 382505..382624(+) (phrC) [Bacillus velezensis strain LABIM40]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment