Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   CP943_RS17625 Genome accession   NZ_CP023665
Coordinates   3435656..3435796 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain Bac84     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3430656..3440796
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CP943_RS17600 - 3430929..3431318 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  CP943_RS17605 comA 3431335..3431973 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  CP943_RS17610 comP 3432060..3434381 (-) 2322 WP_023856154.1 ATP-binding protein Regulator
  CP943_RS17615 comX 3434421..3434585 (-) 165 WP_023856155.1 competence pheromone ComX -
  CP943_RS17620 - 3434600..3435469 (-) 870 WP_023856156.1 polyprenyl synthetase family protein -
  CP943_RS17625 degQ 3435656..3435796 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  CP943_RS17635 - 3436408..3436629 (+) 222 WP_230368259.1 hypothetical protein -
  CP943_RS17640 - 3436672..3437892 (-) 1221 WP_020452793.1 EAL and HDOD domain-containing protein -
  CP943_RS17645 - 3438070..3439479 (-) 1410 WP_229029889.1 nicotinate phosphoribosyltransferase -
  CP943_RS17650 - 3439557..3440108 (-) 552 WP_020452795.1 cysteine hydrolase family protein -
  CP943_RS17655 - 3440294..3440695 (-) 402 WP_026580054.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=249057 CP943_RS17625 WP_003184860.1 3435656..3435796(-) (degQ) [Bacillus paralicheniformis strain Bac84]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=249057 CP943_RS17625 WP_003184860.1 3435656..3435796(-) (degQ) [Bacillus paralicheniformis strain Bac84]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment