Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   COP00_RS10510 Genome accession   NZ_CP023481
Coordinates   1952104..1952244 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus glycinifermentans strain KBN06P03352     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1947104..1957244
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  COP00_RS10485 (COP00_10485) - 1947409..1947801 (-) 393 WP_048353782.1 hotdog fold thioesterase -
  COP00_RS10490 (COP00_10490) comA 1947821..1948459 (-) 639 WP_046131689.1 response regulator transcription factor Regulator
  COP00_RS10495 (COP00_10495) comP 1948542..1950845 (-) 2304 WP_057957515.1 ATP-binding protein Regulator
  COP00_RS10500 (COP00_10500) comX 1950859..1951029 (-) 171 WP_048353781.1 competence pheromone ComX -
  COP00_RS10505 (COP00_10505) - 1951032..1951913 (-) 882 WP_048406751.1 polyprenyl synthetase family protein -
  COP00_RS10510 (COP00_10510) degQ 1952104..1952244 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  COP00_RS10515 (COP00_10515) - 1952734..1953081 (+) 348 WP_232517706.1 hypothetical protein -
  COP00_RS10520 (COP00_10520) - 1953131..1954347 (-) 1217 Protein_2092 EAL and HDOD domain-containing protein -
  COP00_RS10525 (COP00_10525) - 1954502..1955971 (-) 1470 WP_048353779.1 nicotinate phosphoribosyltransferase -
  COP00_RS10530 (COP00_10530) - 1955989..1956540 (-) 552 WP_048353778.1 cysteine hydrolase family protein -
  COP00_RS10535 (COP00_10535) - 1956677..1957069 (-) 393 WP_048353777.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=247510 COP00_RS10510 WP_003184860.1 1952104..1952244(-) (degQ) [Bacillus glycinifermentans strain KBN06P03352]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=247510 COP00_RS10510 WP_003184860.1 1952104..1952244(-) (degQ) [Bacillus glycinifermentans strain KBN06P03352]
GTGGAAAAGCAACAAATTGAAGAGTTAAAGCAATTGCTTTGGCGGCTTGAAAATGAAATCAGGGAAACGAAAGACTCCTT
GCGCAAGATTAACAAAAGTATCGACCAATACGATAAATACACATATTTAAAAACCTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment