Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   COP00_RS06745 Genome accession   NZ_CP023481
Coordinates   1265227..1265403 (+) Length   58 a.a.
NCBI ID   WP_046129962.1    Uniprot ID   A0A0J6E1Q0
Organism   Bacillus glycinifermentans strain KBN06P03352     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1260227..1270403
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  COP00_RS06730 (COP00_06730) gcvT 1260901..1261995 (-) 1095 WP_048356323.1 glycine cleavage system aminomethyltransferase GcvT -
  COP00_RS06735 (COP00_06735) - 1262576..1264243 (+) 1668 WP_057957444.1 DEAD/DEAH box helicase -
  COP00_RS06740 (COP00_06740) - 1264247..1265041 (+) 795 WP_048356322.1 YqhG family protein -
  COP00_RS06745 (COP00_06745) sinI 1265227..1265403 (+) 177 WP_046129962.1 anti-repressor SinI Regulator
  COP00_RS06750 (COP00_06750) sinR 1265437..1265772 (+) 336 WP_096891855.1 transcriptional regulator SinR Regulator
  COP00_RS06755 (COP00_06755) tasA 1265876..1266670 (-) 795 WP_048356541.1 biofilm matrix protein TasA -
  COP00_RS06760 (COP00_06760) sipW 1266739..1267320 (-) 582 WP_046129965.1 signal peptidase I SipW -
  COP00_RS06765 (COP00_06765) tapA 1267317..1268042 (-) 726 WP_046129966.1 amyloid fiber anchoring/assembly protein TapA -
  COP00_RS06770 (COP00_06770) - 1268305..1268628 (+) 324 WP_046129967.1 DUF3889 domain-containing protein -
  COP00_RS06775 (COP00_06775) - 1268713..1268895 (-) 183 WP_048356540.1 YqzE family protein -
  COP00_RS06780 (COP00_06780) comGG 1268977..1269342 (-) 366 WP_048356539.1 competence type IV pilus minor pilin ComGG -
  COP00_RS06785 (COP00_06785) comGF 1269354..1269839 (-) 486 WP_082634619.1 competence type IV pilus minor pilin ComGF -
  COP00_RS06790 (COP00_06790) comGE 1269754..1270101 (-) 348 WP_048356538.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6708.47 Da        Isoelectric Point: 4.4545

>NTDB_id=247491 COP00_RS06745 WP_046129962.1 1265227..1265403(+) (sinI) [Bacillus glycinifermentans strain KBN06P03352]
MNKVEHEKEELDKEWEELIKSALNEGISPEEIRIFLNLGNKTSEASTPIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=247491 COP00_RS06745 WP_046129962.1 1265227..1265403(+) (sinI) [Bacillus glycinifermentans strain KBN06P03352]
ATGAATAAAGTGGAACATGAGAAAGAAGAATTGGACAAGGAGTGGGAAGAGCTGATCAAAAGTGCTCTCAATGAAGGCAT
TAGTCCGGAAGAAATAAGAATATTTCTCAATTTAGGAAATAAGACTTCCGAAGCTTCCACACCAATTGAAAGAAGTCATT
CAATAAATCCCTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A0J6E1Q0

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5

Multiple sequence alignment