Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   CMR26_RS01570 Genome accession   NZ_CP023414
Coordinates   300882..301022 (+) Length   46 a.a.
NCBI ID   WP_108724754.1    Uniprot ID   -
Organism   Bacillus velezensis strain BS-37     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 295882..306022
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CMR26_RS01540 (CMR26_01535) - 296188..296586 (+) 399 WP_020956272.1 YueI family protein -
  CMR26_RS01545 (CMR26_01540) - 296683..297234 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  CMR26_RS01550 (CMR26_01545) - 297252..298718 (+) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  CMR26_RS01555 (CMR26_01550) - 298848..300071 (+) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  CMR26_RS01560 (CMR26_01555) - 300078..300419 (-) 342 WP_007408677.1 hypothetical protein -
  CMR26_RS01570 (CMR26_01565) degQ 300882..301022 (+) 141 WP_108724754.1 degradation enzyme regulation protein DegQ Regulator
  CMR26_RS01575 (CMR26_01570) - 301174..302085 (+) 912 WP_079891433.1 polyprenyl synthetase family protein -
  CMR26_RS01580 (CMR26_01575) comX 302085..302249 (+) 165 WP_007613432.1 competence pheromone ComX -
  CMR26_RS01585 (CMR26_01580) comP 302261..304549 (+) 2289 WP_108724755.1 histidine kinase Regulator
  CMR26_RS01590 (CMR26_01585) comA 304630..305274 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  CMR26_RS01595 (CMR26_01590) - 305296..305679 (+) 384 WP_007408674.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5488.27 Da        Isoelectric Point: 4.9432

>NTDB_id=246853 CMR26_RS01570 WP_108724754.1 300882..301022(+) (degQ) [Bacillus velezensis strain BS-37]
MENKLEEVKQLLFRLENDIREATDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=246853 CMR26_RS01570 WP_108724754.1 300882..301022(+) (degQ) [Bacillus velezensis strain BS-37]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAGCAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

86.957

100

0.87

Multiple sequence alignment