Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   Bateq7PJ16_RS17445 Genome accession   NZ_CP023409
Coordinates   3224798..3224938 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain 7PJ-16     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3219798..3229938
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Bateq7PJ16_RS17420 (Bateq7PJ16_3461) yuxO 3220075..3220455 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  Bateq7PJ16_RS17425 (Bateq7PJ16_3462) comA 3220474..3221118 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  Bateq7PJ16_RS17430 (Bateq7PJ16_3463) comP 3221199..3223511 (-) 2313 WP_041332996.1 sensor histidine kinase Regulator
  Bateq7PJ16_RS17435 (Bateq7PJ16_3464) comX 3223527..3223748 (-) 222 WP_014480704.1 competence pheromone ComX -
  Bateq7PJ16_RS17440 (Bateq7PJ16_3465) - 3223750..3224613 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  Bateq7PJ16_RS17445 (Bateq7PJ16_3466) degQ 3224798..3224938 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  Bateq7PJ16_RS17450 (Bateq7PJ16_3467) - 3225160..3225285 (+) 126 WP_003228793.1 hypothetical protein -
  Bateq7PJ16_RS17455 (Bateq7PJ16_3468) - 3225400..3225768 (+) 369 WP_046381300.1 hypothetical protein -
  Bateq7PJ16_RS17460 (Bateq7PJ16_3469) pdeH 3225744..3226973 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  Bateq7PJ16_RS17465 (Bateq7PJ16_3470) pncB 3227110..3228582 (-) 1473 WP_159377062.1 nicotinate phosphoribosyltransferase -
  Bateq7PJ16_RS17470 (Bateq7PJ16_3471) pncA 3228598..3229149 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  Bateq7PJ16_RS17475 (Bateq7PJ16_3472) yueI 3229246..3229644 (-) 399 WP_032726794.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=246818 Bateq7PJ16_RS17445 WP_003220708.1 3224798..3224938(-) (degQ) [Bacillus subtilis strain 7PJ-16]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=246818 Bateq7PJ16_RS17445 WP_003220708.1 3224798..3224938(-) (degQ) [Bacillus subtilis strain 7PJ-16]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment