Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   CLI97_RS05940 Genome accession   NZ_CP023320
Coordinates   1092465..1092605 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SCGB     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1087465..1097605
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CLI97_RS05915 (CLI97_01175) - 1087805..1088188 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  CLI97_RS05920 (CLI97_01176) comA 1088210..1088854 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  CLI97_RS05925 (CLI97_01177) comP 1088935..1091226 (-) 2292 WP_094247540.1 histidine kinase Regulator
  CLI97_RS05930 (CLI97_01178) comX 1091238..1091402 (-) 165 WP_007613432.1 competence pheromone ComX -
  CLI97_RS05935 (CLI97_01179) - 1091402..1092313 (-) 912 WP_031378407.1 polyprenyl synthetase family protein -
  CLI97_RS05940 (CLI97_01180) degQ 1092465..1092605 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  CLI97_RS05950 (CLI97_01181) - 1093070..1093411 (+) 342 WP_014418765.1 hypothetical protein -
  CLI97_RS05955 (CLI97_01182) - 1093418..1094641 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  CLI97_RS05960 (CLI97_01183) - 1094771..1096237 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  CLI97_RS05965 (CLI97_01184) - 1096255..1096806 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  CLI97_RS05970 (CLI97_01185) - 1096903..1097301 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=246030 CLI97_RS05940 WP_003152043.1 1092465..1092605(-) (degQ) [Bacillus velezensis strain SCGB]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=246030 CLI97_RS05940 WP_003152043.1 1092465..1092605(-) (degQ) [Bacillus velezensis strain SCGB]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment