Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   CLD04_RS16450 Genome accession   NZ_CP023257
Coordinates   3083366..3083506 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain TLO3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3078366..3088506
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CLD04_RS16425 (CLD04_16425) yuxO 3078641..3079021 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  CLD04_RS16430 (CLD04_16430) comA 3079040..3079684 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  CLD04_RS16435 (CLD04_16435) - 3079765..3082078 (-) 2314 Protein_3192 histidine kinase -
  CLD04_RS16440 (CLD04_16440) comX 3082094..3082315 (-) 222 WP_014114983.1 competence pheromone ComX -
  CLD04_RS16445 (CLD04_16445) - 3082312..3083181 (-) 870 WP_095843911.1 polyprenyl synthetase family protein -
  CLD04_RS16450 (CLD04_16450) degQ 3083366..3083506 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  CLD04_RS22180 - 3083728..3083790 (+) 63 Protein_3196 hypothetical protein -
  CLD04_RS16455 (CLD04_16455) - 3083967..3084335 (+) 369 WP_017695529.1 hypothetical protein -
  CLD04_RS16460 (CLD04_16460) pdeH 3084311..3085540 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  CLD04_RS16465 (CLD04_16465) pncB 3085677..3087149 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  CLD04_RS16470 (CLD04_16470) pncA 3087165..3087716 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  CLD04_RS16475 (CLD04_16475) yueI 3087813..3088211 (-) 399 WP_017695530.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=245571 CLD04_RS16450 WP_003220708.1 3083366..3083506(-) (degQ) [Bacillus subtilis strain TLO3]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=245571 CLD04_RS16450 WP_003220708.1 3083366..3083506(-) (degQ) [Bacillus subtilis strain TLO3]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment