Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   CLD04_RS12980 Genome accession   NZ_CP023257
Coordinates   2427719..2428102 (-) Length   127 a.a.
NCBI ID   WP_041334965.1    Uniprot ID   -
Organism   Bacillus subtilis strain TLO3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2422719..2433102
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CLD04_RS12940 (CLD04_12940) sinI 2423659..2423832 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  CLD04_RS12945 (CLD04_12945) sinR 2423866..2424201 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  CLD04_RS12950 (CLD04_12950) tasA 2424294..2425079 (-) 786 WP_017696201.1 biofilm matrix protein TasA -
  CLD04_RS12955 (CLD04_12955) sipW 2425144..2425716 (-) 573 WP_072557060.1 signal peptidase I SipW -
  CLD04_RS12960 (CLD04_12960) tapA 2425700..2426455 (-) 756 WP_017696199.1 amyloid fiber anchoring/assembly protein TapA -
  CLD04_RS12965 (CLD04_12965) yqzG 2426726..2427052 (+) 327 WP_026113671.1 YqzG/YhdC family protein -
  CLD04_RS12970 (CLD04_12970) spoIITA 2427094..2427273 (-) 180 WP_014480252.1 YqzE family protein -
  CLD04_RS12975 (CLD04_12975) comGG 2427344..2427718 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  CLD04_RS12980 (CLD04_12980) comGF 2427719..2428102 (-) 384 WP_041334965.1 ComG operon protein ComGF Machinery gene
  CLD04_RS12985 (CLD04_12985) comGE 2428128..2428475 (-) 348 WP_041334967.1 ComG operon protein 5 Machinery gene
  CLD04_RS12990 (CLD04_12990) comGD 2428459..2428890 (-) 432 WP_041334970.1 comG operon protein ComGD Machinery gene
  CLD04_RS12995 (CLD04_12995) comGC 2428880..2429176 (-) 297 WP_041334973.1 comG operon protein ComGC Machinery gene
  CLD04_RS13000 (CLD04_13000) comGB 2429190..2430227 (-) 1038 WP_041334977.1 comG operon protein ComGB Machinery gene
  CLD04_RS13005 (CLD04_13005) comGA 2430214..2431284 (-) 1071 WP_017696192.1 competence protein ComGA Machinery gene
  CLD04_RS13015 (CLD04_13015) corA 2431694..2432647 (-) 954 WP_017696189.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14319.42 Da        Isoelectric Point: 6.2112

>NTDB_id=245551 CLD04_RS12980 WP_041334965.1 2427719..2428102(-) (comGF) [Bacillus subtilis strain TLO3]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADFVNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=245551 CLD04_RS12980 WP_041334965.1 2427719..2428102(-) (comGF) [Bacillus subtilis strain TLO3]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCAATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGTAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976


Multiple sequence alignment